GIF89; GIF89; %PDF- %PDF- Mr.X
  
  __  __    __   __  _____      _            _          _____ _          _ _ 
 |  \/  |   \ \ / / |  __ \    (_)          | |        / ____| |        | | |
 | \  / |_ __\ V /  | |__) | __ ___   ____ _| |_ ___  | (___ | |__   ___| | |
 | |\/| | '__|> <   |  ___/ '__| \ \ / / _` | __/ _ \  \___ \| '_ \ / _ \ | |
 | |  | | |_ / . \  | |   | |  | |\ V / (_| | ||  __/  ____) | | | |  __/ | |
 |_|  |_|_(_)_/ \_\ |_|   |_|  |_| \_/ \__,_|\__\___| |_____/|_| |_|\___V 2.1
 if you need WebShell for Seo everyday contact me on Telegram
 Telegram Address : @jackleet
        
        
For_More_Tools: Telegram: @jackleet | Bulk Smtp support mail sender | Business Mail Collector | Mail Bouncer All Mail | Bulk Office Mail Validator | Html Letter private



Upload:

Command:

www-data@216.73.216.129: ~ $
ELF>`�@h@8
@@@@��pNpNPPP��ppph�h��������PP88800hhhDDS�td88800P�td��������Q�tdR�td���00/lib64/ld-linux-x86-64.so.2 GNU���GNU�v�|i
�+��n�p��GNU� �e�m}�V�mV�O[!�G#��	����QF�
� Em.������� �\��
�a	�	c
���	R	���i�7#�"�������n��
?�4
��
k
��d#	Cv Q��Z	��
����bD
l�3rs
��^�f��y<������Pa{V
��Dn�
"
�	D�������
n7�
����Su�t��	�w
\5��R�
t�k�d�	�	_:�c��J
�Y
q	���	|
��
�f�A�4	�\c�#{D	��	]!9����WX�, �Ko��	G����-��	�����Q >	�ZK
�
(�
�
34
5/�V����
����U�
��	
.�F"�g__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize__libc_start_maing_freeg_logg_io_channel_unix_newg_io_add_watchg_io_channel_unrefg_source_removeg_assertion_message_exprxmlURIUnescapeStringxmlFileOpenxmlFreeg_hash_table_unrefg_strdup_printfg_file_testfopen64filenodup2g_ptr_array_newg_unlinkrenameg_ptr_array_freeg_ptr_array_add__errno_location__fprintf_chk__stack_chk_failg_get_current_timeg_hash_table_foreach_removeg_hash_table_sizereadg_date_time_new_now_utcg_date_time_formatg_date_time_get_microsecondg_date_time_unrefstrleng_rw_lock_reader_lockfputsg_rw_lock_reader_unlockg_rw_lock_writer_lockg_rw_lock_writer_unlockstderrfflushfcloseabortwriteg_set_errorg_strcmp0g_realloc_ng_strndupstrtolg_strchugg_strchompg_markup_parse_context_newg_strdupg_markup_parse_context_freeg_markup_parse_context_parseg_error_freerecvsendg_strlcpyg_build_filenamexmlLoadCatalogxmlSchemaNewParserCtxtxmlSchemaSetParserErrorsxmlSchemaParsexmlSchemaNewValidCtxtxmlSchemaSetValidErrorsxmlSchemaFreeParserCtxtg_key_file_freexmlSchemaFreeValidCtxtxmlSchemaFreeg_strrstrg_strstr_lenmemmoveg_base64_decodememcmpg_base64_encodeg_malloc0g_mutex_initg_once_implgetpwnam_rsocketbindchownfcntl64listengetpwuid_rstrcspng_vsnprintfstrerror_rg_mkstempfchmodg_hash_table_lookupacceptg_markup_escape_textg_hash_table_insertg_strdup_vprintfconnectg_mallocmemcpy__vsnprintf_chkg_main_loop_quitxmlSecOpenSSLShutdownxmlSecOpenSSLAppShutdownxmlSecShutdownxmlHasPropxmlNodeListGetStringg_time_val_from_iso8601g_mutex_lockg_mutex_unlocksigactiong_source_newg_source_add_pollpipelstat64g_path_get_dirnameg_mkdir_with_parents__syslog_chkg_path_is_absoluteg_find_program_in_pathfgetskillg_get_current_dirg_source_set_callbackg_source_attachg_source_unrefsetlocalegetenvstrrchrg_filename_from_utf8g_io_channel_new_fileg_str_equalg_str_hashg_hash_table_new_fullg_io_channel_read_lineopenlogxmlInitParserxmlCheckVersion__xmlLoadExtDtdDefaultValuexmlSubstituteEntitiesDefaultxmlSetGenericErrorFuncxmlFileClosexmlFileReadxmlFileMatchxmlRegisterInputCallbacksxmlSecInitxmlSecErrorsSetCallbackxmlSecCheckVersionExtxmlSecOpenSSLAppInitxmlSecOpenSSLInitstrchrg_dir_openg_dir_read_nameg_str_has_prefixg_str_has_suffixg_utf8_casefoldg_clear_errorstrncmpmemchrg_main_loop_newg_main_loop_rung_utf8_validateg_strcompress__printf_chkg_dir_closefdopeng_markup_printf_escapedfsyncxmlParseMemoryxmlDocGetRootElementxmlSchemaValidateDocxmlStrEqualxmlNodeGetContentg_get_host_namestrstrxmlFreeDocxmlSecDSigNsxmlSecNodeSignaturexmlSecFindNodexmlSecNodeKeyInfoxmlSecNodeX509DataxmlSecKeysMngrCreatexmlSecOpenSSLAppDefaultKeysMngrInitxmlSecKeysMngrDestroyxmlSecNodeX509Certificateg_malloc0_nxmlSecOpenSSLAppKeysMngrCertLoadMemoryxmlSecDSigCtxCreatexmlGetIDxmlSecOpenSSLKeyDataX509GetKlassxmlSecPtrListAddxmlSecDSigCtxVerifyxmlSecDSigCtxDestroyg_list_freeg_list_appendg_list_removeg_list_lengthxmlAddIDg_hash_table_removeg_timeout_add_secondsg_key_file_newg_key_file_load_from_fileflockforkwaitpidsetitimersigfillsetsysconfgetrlimit64sigprocmasksetsid_exitchdirumaskgetpidg_snprintfftruncate64execvsetrlimit64__memcpy_chkfstat64__realpath_chkg_key_file_get_booleang_key_file_get_integerg_key_file_get_stringg_rw_lock_initg_log_set_default_handlerg_ascii_strcasecmpg_key_file_get_groupsg_key_file_get_keysg_key_file_get_valueg_strfreevg_strerrorOPENSSL_init_sslX509_STORE_CTX_initOPENSSL_sk_numERR_get_error_allOPENSSL_init_cryptoX509_STORE_newX509_verify_cert_error_stringBIO_s_memX509_STORE_freeX509_get_subject_nameX509_freeOPENSSL_sk_new_nullOPENSSL_sk_pushBIO_freePEM_read_bio_X509BIO_new_mem_bufX509_NAME_onelineX509_NAME_cmpX509_get_issuer_nameX509_STORE_CTX_newX509_STORE_CTX_get_current_certX509_printBIO_newX509_STORE_set_verify_cbBIO_ctrlOPENSSL_sk_pop_freeX509_STORE_CTX_freeX509_STORE_CTX_set0_trusted_stackX509_STORE_CTX_get_errorERR_error_stringX509_STORE_CTX_get_error_depthX509_verify_certlibglib-2.0.so.0libxmlsec1-openssl.so.1libxmlsec1.so.1libxml2.so.2libssl.so.3libcrypto.so.3libc.so.6OPENSSL_3.0.0GLIBC_2.34GLIBC_2.33GLIBC_2.4GLIBC_2.3.4GLIBC_2.28GLIBC_2.14GLIBC_2.2.5LIBXML2_2.5.8LIBXML2_2.4.30		
	

	r  +p�����������ii

�ti		���������ui	�~  +p�e�����L�@�����s���Ȃт(݂8�H��X
�h�x&��@��Ў� �������  @ P�H  �P `�X ��� Ф� ��� �� 0�X`h(px3�S�Y�Z�v�y�z��������������	PX`hpx���	�
���
��������� (08@ H!P"X#`$h%p&x'�)�*�+�,�-�.�/�0�1�2�4�5�6�7�8�9:;<= >(?0@8A@BHCPDXE`FhGpHxI�J�K�L�M�N�O�P�Q�R�T�U�V�W�X�[�\]^_` a(b0c8d@eHfPgXh`ihjpkxl�m�n�o�p�q�r�s�t�u�w�x�{�|�}�~����� �(�0�8�@�H�P�X�`�h�p�x������������������������������������� �(�0�8�@�H�P�X�`�h�p�x������������������������������������� �(�0�8�@�H�P�X�`�h�p�x������������������������������������� �(�0�8�@�H�P�X�`�h�p�x���������������������������
 (0
8@HP��H��H�q�H��t��H����5��%���h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h	��Q������h
��A������h��1������h��!������h
��������h��������h������h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h��Q������h��A������h��1������h��!������h��������h��������h������h �������h!��������h"�������h#�������h$�������h%�������h&�������h'��q������h(��a������h)��Q������h*��A������h+��1������h,��!������h-��������h.��������h/������h0�������h1��������h2�������h3�������h4�������h5�������h6�������h7��q������h8��a������h9��Q������h:��A������h;��1������h<��!������h=��������h>��������h?������h@�������hA��������hB�������hC�������hD�������hE�������hF�������hG��q������hH��a������hI��Q������hJ��A������hK��1������hL��!������hM��������hN��������hO������hP�������hQ��������hR�������hS�������hT�������hU�������hV�������hW��q������hX��a������hY��Q������hZ��A������h[��1������h\��!������h]��������h^��������h_������h`�������ha��������hb�������hc�������hd�������he�������hf�������hg��q������hh��a������hi��Q������hj��A������hk��1������hl��!������hm��������hn��������ho������hp�������hq��������hr�������hs�������ht�������hu�������hv�������hw��q������hx��a������hy��Q������hz��A������h{��1������h|��!������h}��������h~��������h������h��������h���������h��������h��������h��������h��������h��������h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���������h��������h��������h��������h��������h��������h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h��������h���������h��������h��������h��������h��������h��������h���q������h���a������h���Q������h���A������h���1������h���!������h���������h���������h�������h�������h�������h������h������h������h������h������h���q���h���a���h���Q���h���A���h���1���h���!���h������h������h�������h�������h�������h������h������h������h������h������h���q���h���a���h���Q���h���A���h���1���h���!���h������h������h�������h�������h�������h������h������h������h������h������h���q���h���a���h���Q���h���A���h���1���h���!���h������h������h�������h�������h�������h������h������h������h������h������h���q���h���a���h���Q���h���A���h���1���h���!���h������h������h�������h�������h�������h������h������h������h������h������h���q���h���a���h���Q���h���A���h���1���h���!���h������h������h��������h��������%�D���%�D���%u�D���%նD���%ͶD���%ŶD���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%}�D���%u�D���%m�D���%e�D���%]�D���%U�D���%M�D���%E�D���%=�D���%5�D���%-�D���%%�D���%�D���%�D���%
�D���%�D���%��D���%��D���%�D���%�D���%ݵD���%յD���%͵D���%ŵD���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%}�D���%u�D���%m�D���%e�D���%]�D���%U�D���%M�D���%E�D���%=�D���%5�D���%-�D���%%�D���%�D���%�D���%
�D���%�D���%��D���%��D���%�D���%�D���%ݴD���%մD���%ʹD���%ŴD���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%}�D���%u�D���%m�D���%e�D���%]�D���%U�D���%M�D���%E�D���%=�D���%5�D���%-�D���%%�D���%�D���%�D���%
�D���%�D���%��D���%��D���%�D���%�D���%ݳD���%ճD���%ͳD���%ųD���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%}�D���%u�D���%m�D���%e�D���%]�D���%U�D���%M�D���%E�D���%=�D���%5�D���%-�D���%%�D���%�D���%�D���%
�D���%�D���%��D���%��D���%�D���%�D���%ݲD���%ղD���%ͲD���%ŲD���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%}�D���%u�D���%m�D���%e�D���%]�D���%U�D���%M�D���%E�D���%=�D���%5�D���%-�D���%%�D���%�D���%�D���%
�D���%�D���%��D���%��D���%�D���%�D���%ݱD���%ձD���%ͱD���%űD���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%}�D���%u�D���%m�D���%e�D���%]�D���%U�D���%M�D���%E�D���%=�D���%5�D���%-�D���%%�D���%�D���%�D���%
�D���%�D���%��D���%��D���%�D���%�D���%ݰD���%հD���%ͰD���%ŰD���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%}�D���%u�D���%m�D���%e�D���%]�D���%U�D���%M�D���%E�D���%=�D���%5�D���%-�D���%%�D���%�D���%�D���%
�D���%�D���%��D���%��D���%�D���%�D���%ݯD���%կD���%ͯD���%ůD���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%}�D���%u�D���%m�D���%e�D���%]�D���%U�D���%M�D���%E�D���%=�D���%5�D���%-�D���%%�D���%�D���%�D���%
�D���%�D���%��D���%��D���%�D���%�D���%ݮD���%ծD����f.����AWAVAUATA��USH��H���dH�%(H��$�1����H�>�H�;���H�;���_��H��H���H�3H��������H������H��H����8�A���+H�{H�5{�������
H�>H�5�H�����H��H����L��$�H�¾ L�����H����L��
1��t���I��A�����?L�-G��1�1�L��H�>�����D����������D����;
E��L��A���
H�)>�1�1����H���{���C������H��I���3�H�3L��1�1���L��H�����������H�������������1����L�%Le�'h1�1�H�5LHH��H������1�H�����H�����g1�1�L��H��H�����1�H���Y���H���q���g1�1�L��H��H���u���1�H���+���H���C��g1�1�L��H��H���G���1�H�����H����H�֭�H��H�5�H�8�c�H�
�H��D$$H���H�5�H�8��H�5
�H���7����KH�=�H�D$(����H��H������H�
Y*H�r=1�I��I����1���M��H�
T*1�1�H����L�-���UL�
�M��AUL�=�L��L��H��L��1�M�����H��H���^�ZY��uA�.L������H��t/�H����M��L��L��AQH��M��L��AU1���AZA[H�žH���
���uC�_L�����H��t1�H����M��L��L��VL�
�L��H��AU1��i�_AXH��E1�1�1�H��H�D$pH����I��H���H�T$pH�5��H��H�T$��M����1�H�
�(H�2<I��1��P�L����H�D$pH���H�C�H�
�H�D$H��H�M�H��H�L$PH��H�D$��H�D$HH��$�H�D$8H��$�H�D$@H�D$xH�D$0L�D$H�L$8L��H�T$@H�t$0���H�D$pH����L�|$xM����
L���/����L�t$(I��H�D$HI��I�L���i��HH�8I����L��L�D$�z���L�D$L��H��I�8�G���L����H����L����H�����P�L���u��D$$1�� H�e���1��������L��1��H�
FH�5N��XH�=s;����1�H��H�5?H��H�,�H�8���H��H��H�5*��H��H�8�f�H��I��H����D�I�D��8/u�� 1�1�L��H�;�?�H����H�=X���6�����H�=?�������0L�%&�H�=>�2�1�H��L��1��#i�D$XH�|$H��$��D$pHDŽ$�HDŽ$���H�D$HH����H��$�HcD$pH�݅���H�D$H��H�D$PH��$�H�D$8H�D$xH�D$0f.�H\$H�T$8H�{H�t$0�H;H�D$HH�����{��H��$��l$xH�D$@H�D$(H�L$@H��HKI�υ����E�H�L$(Hk�I��H�DH�D$�I��L9l$�cI�uH�;�%C��t�E�uE��~�E1��I�UK�dI�H��A�L�p9�����i��E1�A�L�t$(E1�fDL��A��I���D9��H�|$(��E���H�D$ H�D$H9D$Pt
H��$������D$pH��$���~*��H��H��L�d f.�H��H�� �bI9�u�H�����|$Xu)H����H��������H�|$Hta�H�5ȦH�=_1��B�H���H��H��H�������Y
��
H���7�H�����H���#����m�H�O�1�H�
�H��H�D$H�W�H��H�D$���1�� H�$����1���K�����Q�������w�1�H�5N[�)�H�
ڤH���H�5dH�=���x���=��������H�='\����!�������1������������L�%�#1�H�-<PA�1�A�j!L��H�� ���L��1�A�!A�H���SH��H��H��H���H�=�ZY����H�5��H�=��r^H�-�H�{H��������h���H�{H�5����A�ą��C1��U�H���}�H�;H�33H��H�C�W����x
H��$�dH+%(��
H���D��[]A\A]A^A_ÿ1��G�H��H������.H��I�����H���/�����'���H�=�������D$X�������H�=٣E1�1ɺ�H�5��_H���H�=��1�H��$�L�5'�H��H�#�L�=/���I��H��u/�E1�1ɺ�H��H�5���^_H���rH����L���e�I��H���{
H�5:�L��1�L����L��H��H���W���t�H�5�L�������t�H�5��L������t�L�����H�5x�H�xI��H�|$��H�|$H�������E1�1ɺ�H��H��H�D$�^L�L$H����
L���7�L���/��%���H��8�1�1��E�H�
.!H�O9�1�1��)���H�=��8�I���b���H������L$$��L��H�����H����H��H��I���@�H��D$��L�����D$�L$$���C���I��E9e����������L�CH�
�1�1�H��6����J���H��0��1�1��m�H���e�1��.�H��$��l$xH�D$(H�D$@H�D$@9C�3���M������
H�|$(���A�}H�L�
9�uM�ML�CSH�
�1�PH��6�1����]A\���H�ΟH�t$H�
2JH�|$H��H�D$P�p�H��H���NH�1��H���H�5�H�8���8�����D�)�H�-]�1�H�
98�vH��H�=���JH�=���Z��H��H�=���ZL�@1�H��H�`���1���H�|$���H�5�L���y��������I��M��L�� H�<11�1�������H����1����q���H��$�L��8
��H��$�H���=�
L��H�T$X��H�T$XH���3L)�L��H���3�I��H�����L�
�L��A�<�t�GH��A����u�H���H���H�
��<�u�I���I��A�A�<�u�=u	H9���L�����H�|$x�������I��A��1�V�H�
��H�-P1���1�H�
�1�H��4���_AXH�
zH��4�G�����H�Z��1�1��g�����L��5H�
���H�53�H�=��GH�
%H��6��H�{H�5���y�A���H�
�1�1�H���������H�L$PH�t$H�|$H����H��H�����X���H�=�+H�ŋ��E4�P����H�=�H�E��H�}H�E�^�A��L�e�H�
�5H��k���E,�����$\���81�H����<H���%�EH���
H����1�1�E1��E��H�y�� 1�H�H�1���H�=:���H�
�1�1�H�U�� �������
H��$�H9�$�v
H�T$x�DL�|$xH��$�M�������A��L�Z�H�
�H���1�1��n�L��T1�H�
��6H�5�����A�OI��A�<�H��u�L����"u	�H���H�5�	�<�u�H���H��D�C�<�u�E��t
A��#����H)�L�D$`H��H�T$h���H�t$hL��H�D$XL)����L�D$`H��I���L�����H�|$x�y��H�|$X���H�|$X1�H���-�����1�H��L�������wL�����L��H�D$`�*��H�T$`H�t$XH�|$H�F��b�L�B3H�
����H��H�=��D����H�H�5{��1��$�H�=�*��H�=+���H�=d����H�=1+���H�=]+������H�=�-��H��1�H��1���ZH��L��1��K��H��H��I�������x0u\H�= /��L��H��H��1��ZL���.���$����$�AWH�k.1��M��I��H�
J�P1��-�XZH�=l.�_�L��H��1�H��1��MZL������H������L����H�
>�1�1�H��.����C���H�T$PH�t$H�
3
L�D$(H�|$�d��L�D$(I��@�H�
�1�1�H���������A��1�H��01��i���������H�	0�1�1��C����I�����H��$��l$xE1�H�D$(������I�ؾ1�AQ�I��H�
H�-P1����AZA[L�%
�H�=�.��1�H��H��L��1��YH������)�����H����1�1����Y���L���&���A�U���L�%��H�=�*��1�H��L��L��1��X�D$X���L��H�B11�1���<�1����H�|$x���L�����H�|$H�������1�H�
��1�H��0���H���?���L�@H��H��(1��1�����H�|$���H�|$x����H�=:+���H�L$H��1�H��1���WH�|$�_��L���W������I��L���H���2L��A�<�u�@��"�e���H�J�A���H��$�L�j�1�H�
	H��)�L�H1��"��H��$���������yH�5!�H�=����PH�L$XH�(1�1������H�|$X���L��������H�
�H���1����A���e�E1��.��H�5`�H�=���TPH�
mH�/�:�����-H�50�H�=���$P��I�ؾ1�D�H�
�H�<%1��-�������1�I��^H��H���PTE1�1�H�=��c��f.�H�=�H��H9�tH���H��t	�����H�=�H�5�H)�H��H��?H��H�H�tH�ݔH��t��fD�����=��u+UH�=J�H��tH�=�����d������]������w�����������1����HcO`H��H��H�˕DŽ��H��tH�����f�1��ff.�f����ff.�ATI��USH�?���A�D$��~91�fDI�D$H�,[H��H��H�|(�e��I�D$H�|(�V��A9\$�I�|$[]A\�A�����
��H� ���Hc�H�>��@H�����H�����H�����H�����H����H�����H�����H�~���H�z���H�w���H�z��H������ATUH��H��H�?�Z��H�}�Q��L�eM��t%I�<$�?��I�|$�5��I�|$�+��L���#��H��H��]A\���@H����UD�GH��A��
��H�
�Jc�H�>��@H�����H��]����fDH����H�}���H��]���DH����H�} ���H�}0���H�}8����f�H��w��H�}�n��H�}(�e���H��W��H�}�N��H�}8�E��H�}@�<��H�}(�3���W���fD�H�
@��1�1�H�H�;���/���fD��USH��H���,���H�پH��=H��H���!��H��C(���H��1�[]�ff.�f���SH���(��u	1�[�D����C(1�[����SH�����:w#�H�
��Hc�H�>��f.��[���[���[���[��H��I�1�1�L�F�A�RH��H�Q���I��H�
��6H�57�1��W����[��L����1�1�A�;H�
��H�����L�@I�ff.���SH�����:w#�H�
��Hc�H�>��f.��[���[���[��H��H�1�1�L�F�A��H��H�Q���I��H�
��6H�57�1��W����[��L����1�1�A��H�
��H�����L�@H�ff.�H�!�ATL�%���,L��H�5��H�8��H�
�H��1�A������ 1��T��H�ՏL��1�H�5��H�8�i�A\�ɏ�H���AT�H�k�H�5��H�8�����������L�%��A��1�1�L��H���������l���	~?Lc���Mi�gfffI��"A)�D���L��H��1�1���A\���f.��~�A���fDA��1�1�H��
�]������M���f�H���AT��QH���H�5��H�8�,����������L�%��A��1�1�L��H�l�������x���	~?Lc���Mi�gfffI��"A)�D�ĐL��H��
1�1���A\���f.����A���fDA��Q�1�1�H��
�m����Q���Q�M���f���AUL�-��I��1�ATH��
��L��USH��1�H�����1�1�H���A��H��tLH��I��1�1�L��H���������H�����H��I��H�)��M��tH��L��[]A\A]�@I��L��1��H�G�1�E1����H��L��[]A\A]�@��UH��tH��H�?H��t�F��H��]�=��DL�1��1�1�H�
2�H��A�Y�?��L��D1�H�
�
�6H�5\��~��ff.�AWAVAUATUSH��dH�%(H��$�1�H����H�wL�5��1�1�H��L���y���H��I�����������C$H�5^���H���HD�L�������L��I���������L���B��M��tL���%������������`H��$�dH+%(�kH�ĸL��[]A\A]A^A_�@H�t$L���S��H�KH�L$�����K$�����r���S E1�I�ą���A�D$A��A������E��I)�H�,�J��H�$�9��L�������tL���O����u:L��L��H������H���t7I�$H�$�H�(L�4(L�<
L���e����t�L��H�����H���u�A�D$��t1�@I�$���H�<�����A9l$w�L������1�H�L$�H�5���C$�T���fDA��D9{ �����H�sD��L��1��y��L��H��H���k���H�������u�����D�k��H�
�H���1�D��1��|������HcCH;C�k������DH�D$@��K$���O�����@L�$�H�
*��1�H�\A�H���L��A1�H�
��6H�56��X���H�
9�H��	L��1�������~����i��f���UH��SH��(�E�dH�%(H�D$1�H�����H]@1�H;$|H�T$dH+%(u.H��([]�f�L�EH�
��H�F	1����R���������fD��UH��SH��(���dH�%(H�D$1�H�����H] H;$��H�T$dH+%(u
H��(��[]����ff.���H��H�=�1�H�5�����s��H�=Ԋ������������H���@��H��H�=��1�H�5����3��H�=�������������e�H���@��UH�-�SH��H��dH�%(H��$�1����u=HcC`��������H��$�dH+%(�NH�Ę[]�f.��=R�H�満���H����A�aL���H�
��H=���Hc$��@��fo$foL$foT$ fo\$0fod$@fol$P�fot$`fo|$p
����%�-�5�='�wD��1�f������@A�bL�6�H�
T�H�=�1�1����L��>1�H�
��6H�5��6��fDH���1�1��������Q�����AW��AVAUATUS��H��#8�u"����H��[]A\A]A^A_�f.�H��H���I��I��LD�H��H��H���L�5��LD���� t3��L�5����t!L�5����t��L�5��H���LE�����I��H���H�5��H�����H���DL��H�$����L�$H�={�Hc��Hi��MbL��L�D$H��&)�1��U��H�|$H�$�g��L�����L�$H�5*�M��IE�L��H�=0�1�L�$M��L�����H�<$I���&��M��tL���)��A�|�
uA�D�L�m0L�������E(��upH�uH����L��������xWH�}�L�������EHcEH;E��L�����L������HcEH;E��L���T��L���|��@L���P��L���x������L�5����@�����=�L�5�H��LE��m���@H�}t�L�����L���I��H�}trL������L�����H�uH������H�V�H�M�E(H����H�81�����P����H�}����:���f�E1�H�5���d����H������H�E�f�H�}�����E$H�����H�E����=H��������j��L�����E1�H�5.�������ATSH��dH�%(H��$�1���@"A��H�����=����N��H���t(H��$�dH+%(��H�Ę[A\�fD�����8H�Ã�t)�L��D�D��I��H�g1�1������@H��1�1�����L���1�1�H�
��H���A�����L�#:1�H�
*�6H�5������f�H��H��H��H���H�D�$$��������ff.���ATUSM����M��E�H��L��A��w H�r�D��Hc�H�>��f�D�[I��L��]H�
��1�A\��[��H�5��H���)�������[]A\�fDH�5��H�������u����DH�5��H���������y����CH�{��p�sHc����HcSH�CH�RH�D��HcCH�{H�@H���@�HcCL�CH�@I��H�@���U���H�5�H���a�����9��3���fDH�5�H���9��������HcC�H�@H�CH�D���HH�x�i�hHc�H���=���H�TmH�T�������H�BH�BHcSH�sH�RH��H�B����@L�v��1�1�H�
}�H�z�A�n�7��L��71�H�
��6H�5T��v���fDH�5:�H���a����ueHcC�H�@H�CH�T��HcBH�JH�@H���@�����f.�H�5��H����������������fDH�5��H�����������������fD��ATUSM����M��E�H��L��A������E���JH�5��H���������CH�{� �p�sHc�詿��HcSH�CH��H�D�HcCH��HCH�@�HcCH��HC�@�HcCH��HCH�@��[]A\�fDA����H�5��H�����������E1�HcCH�SH��H�D��H�i�hHcCHc�H��H��H��HCH�x����H�T(�D�"H�BHcSH��HSH�B�[]A\�D�[I��L��]H�
���1�A\��s���H�5-�H���A����u��[]A\�f�H�5��H���!�������A��*����L����1�1�H�
��H���A�1�w��L�51�H�
��6H�5��趽��fDH�5N�H�������u
�[]A\�f�H�5~�H�������u=��_���f�D�L��I��H�
����1�A������i����f���@H�57�H���1��������������ff.���ATI��UL��SE�HA��w<H��D��L��Hc�H�>��H�5��L���������af�D�K[M��H��]H�
���1�A\麾��f.�H�5�L�������u��C[]A\ÐH�5+�L���a����u��C[]A\ÐH�5�L���A����uM�C[]A\ÐH�50�L���!����um�C[]A\ÐH�5��L�������um�C[]A\ÐH�5��L�����������C�C���������C0�;����H�5��L�������uE�C�����H�5�L�������������C���D�C	���@H�5O�L���I����uX�C����f�H�5�L���!�����Y����C
���D�C(���@A��1���H�5�L��������u�C�X���H�5��L�������u�C�9���H�5��L�������u�C����H�5��L�������u�C���H�5��L���b����u�C
����H�5��L���C����u�C���H�5v�L���$����u�C���H�5a�L�������u�C����H�5O�L��������u�C�`���H�5��L���������W���H�5��L��������k���H�5�L�������u�C����H�5S�L���z����������{�C�i����C ����D��D�BH��A����H�
��D��Hc�H�>����B��t(�����B���B���B	��D�BA��t�A�����B�@��B�f�D�BA�@���v�H�
T���1�髺��SH�
���1��H��/苺��L��1�1�H��H�.��A�y���I�غ61�H�
u�H�5��)���f����'���H�
����1������H�
q���1�������AUH��H��ATM��USH��H���1���D�KA����H�d�H��D��Hc�H�>��@D�CA����H�{�I��H�
u���L��1�聹��H��H��[]A\A]鿵���D�CH�
��A��
�1��
H���D����������C$���
1�H���!����C�@D�CA����A���HA���H�{8�L���H�k81��C0�X���f�D�CA���
A����A�����C0H�C8����f.�D�CA���RH�{����H�k1����@D�CH�
E�A��
�������L��1��<�������D�CH�
�A��u�H�{(�u���H�k(1����f�D�CH�
��A��
u�1��
H������������C �O���D�CH�
-�A���k���H�5 �H��茾��A���E����C ����D�CA������A��	����H�
6�����@D�CA����1��
H���K����������C���f.�D�CA����A�������H�
,����@D�CA���ZA���XH�{@�F���H�k@1��Y���f.�D�CH�
=�A���k����
1�H��謽���C�#���@D�CA��
��H�{�D��Hc�H�>��fDD�KE���L�-\fH�5��E1���I�uI��H��� ������8A��A��
u��C���f�H�k1����H�+�1�1�L��H��H���A���i���I�غ61�H�
��H�5��謳��@H�
a��l���@�C(H�C0�#���@H�{8�����H�k81��	���f.�H�{0����H�k01��C(���I��H�
~�����H�{ �����H�k 1����f.�H�
z�����@H�
Q�����@H�
�����@Mc�H��dI��B� �C���a����C �U���fD�C H�C(�;���@H�{(����H�k(1��C ����H�
���<���H�5��H���]���A���E������H�5��H���=���A���E�������H�5��H������A���E�������I��H�
��L��1����������f�H�
�����H�
��������ATUSH���H��H��H��M������D�H��A��t"A����A��tZ[H��]A\���fDHcCH�@H�CH�D��H�PH���"�@��H�H�@H��H�xu.H�h1���DHcCH�SH�@H��H�x���L��I��H�
�1�������[H��]A\�S���HcCH�@H�CH�D��H�PH��tv�@��H�H�@H��H�xu�H�h1��"���@A��L�P�H�
`�H�]��1�1�����L��'1�H�
���6H�54��V���fDA�L��H�
���f.�A�
���H��1�����H��HcCH�@H�CH�\���]���H��s���D��ATUSH���7H��H��H��M���>���D�H��A��t"A����A��tr[H��]A\����fDHcCH�SH��H�T�HcBH�RH��H�T�H�z��L��I��H�
f�1����u���[H��]A\鹭��f�HcCH��HCH�x�u�H��1��#���H�SH��HcCH��H�\��j���H��P���f�HcCH�SH��H�D�H�x�q���H�h1��'���f�H�jHcS1�H��HSH�R��D����DL�^��1�1�H�
e�H�b�A������L��%1�H�
���6H�5<��^���ff.�AW1�AVI��H�=�`AUI��ATUSH��H��HdH�%(H�D$81��1�H�H�T$ H�D$H�D$H�D$ H�D$(裯��L��I��蘺��H�5�lL�$�H�y�H��I��H�=r�1����L��H�������H���G�����uS�D$$E1�A�EH�D$(H�L���H���H�����H�|$�֫��H�D$8dH+%(��H��HL��[]A\A]A^A_�H�L$H�T$L��H���H��u�H�T$H�t$H�L$L��������t���H�D$I��1�H�
��H��L�H1�����H�|$�e����D$$L�l$(��~)��L��H�@M�d�f�H��H���t��I9�u�L��A����������Ǯ���AUATUSH��H�$H��H�$H��dH�%(H��$(1�H��H�I��H�I��H���@���uS获��D�A�����{,1ɺ(H��迶����u�H�
��H�����1�聲���C01��"fD��x9Hc�H��H���.���I�E1�I�$H��$(dH+%(u<H��([]A\A]����D�1�H�
o��1�H���������蠭��AVE1�AUI��ATI��UH��SH��H����H�ڋ},1�L��L)��
�����xH�I�L9�vOO�,4��f��{���D�A��t�1�H�
���1�H�Ľ膱��[�]A\A]A^��[1�]A\A]A^�D1�E1�H�
��1�H�3����A���[1�]A\A]A^�fD��AWAVAUATA��H��UH��SH��dH�%(H��$1��J���H���萮��H����H��I�������L��H������Ƅ$�Lc�L���9���H��I���^���L�����$���AUL�-c�1�UE��M��L��SH�����P1��z���H�� E��u.�C�vQL�����A��L��I��H���1�1��C���H��$dH+%(u\H��D��[]A\A]A^A_�A��L��H�s�1���1�A�����DI��H�57�L����������o���ff.�@H�AhAW1�H���AVH�5$�AUATUH�8舡H��H���TI��H�
��1�1�H���� �m���1�H�5��1�H��芨��1�H�5��H��I��1��t����L��I���D���A�Ņ���L����������L��衩��I��H����L�-~H��1�L��L���޶��L���v���H��iH��H����莩��H��iH��H����L��L��1�A����L�����L���h���L���`���H���X���]D��A\A]A^A_�L��H��1�1���`����fDL��H��1�1��E1��=����H�=�i1�H���1�H�5���J���H�����f�H���1�1����E1��S���H�	��1�E1��ڭ���-���DH�	��1�E1�躭���
���D��UH�f�� 1�1�薭��H�-fH�}�V���H�}�M���H���E���蠋�H��e�O�����%��H�=^hH��t�4���H�IhH�=:hH��t�8���H�%h�x���S����]�ff.��ATUH������H�5¹H��I���ҫ��H��t�@L��豩��H�+�L��H���/���H��tH�hH��莩��H��L��H�P����H��L��]A\�@AWE1�AVAUATUH��H�� dH�%(H�D$1��h���H��I���]���H�t$L��H��蝱��H�t$H��I��荱��H�T$I��H;T$uH��L��E1�������A��L�����H���ڣ��L���ң��L���ʣ��H�D$dH+%(uH�� D��]A\A]A^A_��t���@AUATUH��dH�%(H�D$1����H��I��H����L��H���i���H�4$H�����H��I���b���H��H�$H��H�|8轤��foI��I�T$H�FICATE--I�D$A�EA�D$---
��tAA�D$I�}I�T$��7@��t��@�2H����@to�7H��@��u��t�
H��H�CATE----fo�L��H�B�-
f�B螢��H��薢��H�D$dH+%(u%H��L��]A\A]�f��B
1�H���k����,���ff.����H��H�=�btNL�7��1�1�H�
0�H���A�q�E���L��1�H�
���6H�5b�脣��@��f���H�xH�{b����1�H���ff.�@�Jb��uH�FbH�Gb�fDH��1�H�5C���H�=b���H� bH���ff.�AWAVAUATUSH��H�$H��H�$H��x1�L�=��H�t$L�d$0H��L�t$(H�T$L�l$`dH�%(H��$h 1�L�d$(M�� L��L��H���G���A����u
H�D$(H��uvD�L$�ܭ���8	u7����t/SH�g�1�I��j	D�L$L����1��ܨ��XZ���H��$h dH+%(u0H��x []A\A]A^A_�fD�PH�L$�H�L$�@�1���#���AU1�ATA��USH���H��(dH�%(H��$1�虥�����1H�{�Ÿf�D$�������H�sH�|$�lL�l$�����nL����ݫ������H�{H��$��$������\H�{E������Š�����H�{H�T$H�t$�
���H����H�{�T$�t$�Ф������1������������M� ��葭�������k,E1��k�����D�A������L�CH�
C�1�1�H�����������f��۫��H�
�H��1�D��1�A����H��$dH+%(�NH��(L��[]A\A]�fD��讟���������q���L�CH�
��H�ijD��$f.��K���L�CH�
��H���D��1�1�A��R�����軠���`���fD����L�CH�
@�H�,�D��@���H�
$�H�v�D��1�1�A�����@L�CH�
��1�1�H����A��ʥ���s���D苪��H�
��H�.�D����k���L�CH�
��H�زD���������ff.��AUATI��UH��H�� dH�%(H�D$1�謧��A���E��uH�T$dH+%(uTH�� ]A\A]�DL�l$H�t$H��L���k���H��t1���f�H�t$L��L���P���H��u�D$9D$������v���fDAWAVAUATUSH��H�$H��H�$H��h1�L�=�H�t$L�d$ ��L�t$L�l$PdH�%(H��$X 1�L�d$M�� L��L������A����u
H�D$H��uuD�L$�����8	u6����t.SH�&�1�A��j	D�L$L����1�����XZ���H��$X dH+%(u,H��h []A\A]A^A_�fDH�8��H�L$H�1���_���ff.�@AVAUATUH��S耠��I��1�I��wBE1�1�L�5 ��@�|\u9E��u4H�XA�H�|L���m���H�I9�wո[]A\A]A^��[1�]A\A]A^�DATI��UH��SH���H��a�����tML��H��H����I��H��uL��[]A\��I��1�H�
��1�H�����ɢ��L��[]A\ÐI��A��1�H�
��H�A�蝢��L��[]A\�DAVAUATUSH��H�$H��H�$H��I��I��H��A��L��L�ɾdH�%(H��$ 1�L���x���Ƅ$����H��$���H��E��I��PL��H�W��S1�1�AV���L��H��$ dH+%(uH�� []A\A]A^��k���ff.�AUA��ATI��UH��SH��H���L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�����I��I��D��8H��$L��H��H�D$H�D$ H�D$�$ �D$0���H�D$dH+%(uH���[]A\A]�莜��ff.�ATU��SH�����A�ą�x����ҟ����u:D��[]A\�fDI��1�H�
_��GH�5h�H�=a�����D��[]A\�I��H�
�1��]H�5<�H�=5����D��A������š���H���USH��H�Z[H����H���Ћ},���udH�} �E,����H��t
�?���H�E H�}����U8H�E��uo�EP��uHH�}诗��H�}覗��H��H��[]阗����+���H�} �E,����H��u��f�H�uH�=�Z耤��H�����(�f�H�]H���4�����y�I��H�
~�1��SH�5��H�=�����X������L��H�
.��1�H�T�A������L��1�H�
���6H�5.��P���L�ԬH�
$��1�H��A���ɞ��L�R1�H�
Y��6H�5���������G����AUATUSH��H�$H�����L��$PI��H��L��$XH�ʄ�t@)�$`)�$p)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H��$(1�L�l$ H��H��$L���$ H�D$H��$0�D$0H�D$����H��1�A��Ƅ$'I��L��1�AUH�U��蛝��XZH��$(dH+%(uH���[]A\A]�����AUATUSH��H�$H�����L��$PI��H��L��$XH�ʄ�t@)�$`)�$p)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H��$(1�L�l$ H��H��$L���$ H�D$H��$0�D$0H�D$���H��1�A��Ƅ$'I��L��1�AUH�5����{���XZH��$(dH+%(uH���[]A\A]�����AUA��1�H�
��AT��I��H�v�USH��dH�%(H��$�1�����M�����X�I���I�|$H�ŋ+W�P�E4�W���I�|$H�E���H�t$�
H�T$H�EA�$H���D$n�E1��H�1��f�OA�|$,茝���Å���M�D$1�A����1�H�
z�H�;��^���L�eH�=�V�],L���8���H����L�eH�=iV�EPL������H��t��R9��L�MD�E4�e1�H�
�H�5��H�=;��v����},�N���H��H��HI��H�����L��E(�I���H��$�dH+%(��H��[]A\A]���S���H�
��H�ب1�D��1��d���L������H�������f�H�5ŨL�������*���H�����H�=3���Q�0����1�H�=J�H��I��1�赓��L��I���ʑ��L�� 1�H�j�1����L��躖��L��H��H������E4H��L�E��A��H�
z�PH�5��1�H�=ѻ����L���d���H���<���XZ����DL�d��1�1�H�
ŧH���A���W���L��	1�H�
���6H�5t�薒��fD��v���L��I���8���H�=ITL��H����������蜔��ff.��AWH��AVAUATUSH��(H��$�H��$�L��$�L��$���t@)�$�)�$�)�$�)�$�)�$�)�$�)�$)�$dH�%(H�D$h1�H��$`�D$PH�D$XH�D$pH�D$`��O�P�D$T0t+H�D$hdH+%(��H��([]A\A]A^A_�DH�t$P����5�PH�D$���7H���H�T$H�5}�H�D$H��1�L�=ߴ�r���I����s����;O1Ҿ������Ņ��f�H�t$0���)D$0f�\$0H�D$4�����K���f���H�t$@���)D$@f�\$@�D$D�輓����yX����H�
,�H��1�D��1��������}���L��H�{��1�1����H�$��M����L��诓��H��H��Z0H�D$$��Lc�H�$�L���D$,胝��H�$fog�L��I�čB,AD$I�|$0Hc��A�$H�D$$foM�H�$H�D$$AD$I�D$$�D$,A�D$,�ێ�����#1�L��L����t���9������L��H���D��1�1�E1��	������r���L���ʍ��L�����H�$H�
��1�1�H���Ε��H�<$蕍��L��荍��H�
�1�1�H�����0N藕��H�|$�]����U����H�4$1ɺ��莙��H�Ã�tv�1���H��L��A�ًH�.��1�A�E1�P1��6�����蟏��ZY�&���E1�DL��H���1�1��E1��������n������f��\$$1�1�L��H�����A���ϔ����
����H������E1�I��H��f���1ɉ�D�D$D)�H�4$蹘��H�4$D�D$������A�H�H�D9�wʼn��ގ��I�~腚��L��H�$H���&���L���������[���H�5��H��薖����t2H�5��H��胖����tH�����L���ߋ���s���f.�1�H�
��1�H�Q����H��謋��L��褋���^L���/���H�
����1�1�H�O�誓���0LH�T$H�|$H�51��8���I������K���H�
t�H�7�1�D��1��\����J��������H�
D�H��1�D��1��,��������A��L��H�7���fD�ӗ��1�L���D�H��1�������Q�������@1�L��H��1��������)������H�a�L�=��H�D$���L��H�������(������ATUH���H��$@H��$HL��$PL��$X��t@)�$`)�$p)�$�)�$�)�$�)�$�)�$�)�$�dH�%(H��$(1�L�d$ I��I��H��$��L��H�D$�H��$0H�-W��$�D$0H�D$�	���1�1�H��L��蕑��1�L��H�����H��$(dH+%(uH���]A\�������AWH���L�=�AVA��AUI��ATI��UL��SH��H��M��I��L���t$PHD�H��H��AQHD�1�1�D�L$A��US���H��I��E��t$XD�T$L��L��L���1�ARU���H��8[]A\A]A^A_�f���UH���� 1�1�覐��H�-'IH�}�f���H�}�]���H���U���H�
��1�1�H��� �i���H�=�K蝐��H�=fKH��t�<���H�QKH�=BKH��t�@���H�-K�А��諒���V���H�ڟ1�1�� �����H�Y�1�H�5�����1���G規��fDAVAUATA��UH��SH��H��0dH�%(H�D$(1��V���H����H�pH����H�}@��Ҋ��H��H�����8u9A�H��FH��H�D$(dH+%(�
H��0D��[]A\A]A^�H�t$H���;���A�Ņ���H��蘇��E���Hc�FH�\$H+$H9�~�L�5ʞH��L�-8�A��1�AVL�%2�L��I��L��1��Ŏ��L��1�M��A��H��L�����E1�XZ�5���A��6���DHc%FH�$L�5f�H+\$H9�������x���I��I��H�
��1�H����1��F��������܉��ff.����PX1�H��I��A�ѾH�K�1�H������L���1�H�
���6H�5%��G����ATUS��	��H�-lF��L�%�FH��諅���uF��tjH��艇��Hc�H�h,A������u!1�H�5]F����������A���hH�=)E�ԍ��H�5�F�X`H��I���/���L��[]A\�1��GL���H�I�|$�P�����t�=�E1���褆����y0�8H�5'�H�=������0H�5�H�=u�����=�E1����Y�����x�f�(F	�zE�F�FH���H�hE�NE�����T���E1�8�ʍ��H�+��1�H��1��b�������ff.�f���UH��SH��H�?�����MH�}��~71��
@H��9]~&H��H��H����u�H�xH���҃��H�}9]��ă��H�}H��[]鵃��D��AWAVA��AUI��ATM��UH��SH��H���dH�%(H��$�1�H�t$ �_������'H�T$H�t$H�����H��ux�D$<D�L$D9��~�D$@�T$9����D$8����D9���M��tE�M1�M��tA�$H��$�dH+%(��H���[]A\A]A^A_�@L�=��1��1�I��I��H���L��H�D$�ڊ���|$<H�t$��H����L�T$H��L��L�T$����L�T$���!D�L$<I��L���H�:�1�1�L�T$�|���L�T$�_D�;���I�ؾ1�D�H�
��1�H�&��I�����
����D�D$<L���1�H��1�����L�T$L���ށ��D�L$<�T$@D�L$�T$����H��I��H�
��PH�"�1��1��̉��X�
Z���H��A��I��PH�
N�H����DH��E��I��PH�
.�H�/��DH��L���I�ًD$DI��H���1�P1��Y���H�|$����Y�
^�����ބ��ff.���ATH�=�US�l���H���-�H��H��������t"�H��������tv�H������ue�H�����A�ą�tA�H��苀��D��[]A\���H���s����Å�x]I��H�
�1�1�H�@�� �~����@I��1�H�
ܨ1�H�s��E1��V���H������D��[]A\�fD����H��I��1��A��H�
S�H�t��P1�����H���1�1�A��I��H�
b����XZ�#����9H�5ΗH�=����ff.���UA��H��H���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$��$H�D$H�D$ �D$0H�D$E��tT��>��t.H�������H��H��H� ��1�蔅��H���~��H�D$dH+%(uH���]�H���ȅ���H����Y���f�AWAVAUATUS��H���H�<$�L$D�D$L�L$dH�%(H��$�1����`H�<$I��脌��H�5�>H�=�H��H��1����H��I���~����L���Q�A�ą��>H�5����~��H��H���M����H��H�=A��ԁ������[H��H�=ǘ輁������C�����C��\$,H�@I�D�H�D$ I�}�
���H���e���H�=�H��1�����H��H��I���f���L��A���K}��A�����E�U1�E��I���H�pH�=
�1����I��L��H��� ���L��A���}��A�����H��A9]��I�UH�[H��D�H�PE��t�H��H�=�1��4��I����A�L���}������E1�L���|��L���|��H��$�dH+%(��H���L��[]A\A]A^A_�H�
���1�1�H�K�A�E1��k���H���c���L���}�����cM���{���L���}�����k���M��H�
H�1��SH�5N�H�=˥�V��B�����+���L�-�H�5%<H�-�H��I��L���L��H��1��}��L��I���{��L���|�����qM��H�
��1�1�H�����E1�蟃��L���g{��D�\$E�����|$H�5�;H�*����oH�=��1��}����H��I���q�A�ƅ���H�5(����{��H��H���
H��H�=j��~������yH��H�=����~������a�t$�����D$L�t$L�d$��M��H��I�D H�D$I�<$M�l$� ���H���x���L��H�=��H��1���|��H��H��I���v~��L����\z�������A�L$E1��I�f�H�pH�='�1��|��H��I��H���0~��L�����z�������I��E9l$��L��H��ID$�8u�H��H�=����}������f.�H�=��1��{��H��H���z�����?1�1�I�辀H�
��H������H���y������E1�E1�����DL�d$H�
��1�1�H�V�A��y����	���@H��H�=k��A}���������I��L9l$ ������\$,H��H�=0��}����������H���~������H���Շ����������^H���}�����qL�4$L�d$<H�l$8L��H��L���:��H���}L��L�-݌H�-܌�ۆ��H�5�8L��H��H��I��L�[�1��Jz��L��I���_x��H�t$@L���B��������T$`�t$\L���}������	L���*x���D$������H�D$�gL�V��1�1�H�
ݒH�Z�A������L���1�H�
���6H�54��Vy��fDM��H�
��1��SH�5�H�=������t����H�<$E1�1��҅��H�5�7L��H��I��H��L�R�1��Ay��L��E1�E1�H���Pw��H���Hw��L��E1��=w��L���5w��H���-w������M��H�
^�1��SH�5d�H�=��l���f����M��H�
.�1��SH�54�H�=���<���%����H�D$L�-��H�-��H�<$��H�5�6H��L��I��H��L�p�1��_x��L��H���tv��M�����H���v�����.H�|$�$H�5�6H�=�1�H���x���H��I���^v�������H��E1��Fv�������L��1��/v�����H��L���\�������H�|$L���G�������M���!L���v����xUL�d$H���L���H���v�����<���I��H�
ʋ1��SH�5ЋH�=M���������A��"���M��H�
��1��SH�5��H�=������H��H�=ݐ�)y����������I�� L;d$�c���L�d$H��H�=���x������y���H���z�����<H��較������~������H��L�-��H�-����y��L�d$����蕁��H�
��H��1�D�(�1�I�� I���|���6���f��[���H�
T�H���D�(I�� I���1�1�E1��a|����@�H���[t���������H�=��E1�E1��qcH�$H��1�H��1��^�I��1�H�
��H���1��{��L�d$H�D$�H���s��L��A��s��L���s��H�|$�s���`����L����s������M���_����I��H�
��1��SH�5��H�=1��������H��H�=E�1��u��H��H��I��衁������������H��M��I��H�Q��1�H�
3�P1��{��XZL�d$H�D$����fDL��H�=Վ1��t��L��H��H���1������������H��I��M���1�PH�ɰH��H�D$ H���H�D$H��1��z��A\XL�d$H�\$H��1��1�H��H�Z��oz��H��L��贀������H�|$L��蟀�����W������H��M��1���PL�D$1�H�L$ H�T$�z��H��M��H��1�1��z��ZY�	�����~��H��M��1���PH��L�d$H��M��H�D$ H���H�D$H��1��y��AXAYH�\$�����s~��H�
l�H�ʌD�(I�� I�������P~��H�
I�H���1�D�(�1�I�� I���Yy���r�H�<$L��H�����I��H���|�T$<�t$8L���iv������D�D$E�������H�<$�*��H�5+1L���H��H��I��H�=�1��r��L��H���p��H�D$�-����}��H�
��H�Ջ1�D�(�1�I�� I���x���,��b}��I��A�H��I��M��1�PH�L$ 1�H�T$�ix���1�I��H��H�X�1��Nx��^_M���S�������	}��H�
�H�`�1�D�(�1�I�� I���x����H�=6�E1��>_L��1�H��1��/�M��1�H�
n�H���1���w��L�d$H�D$����L�$M��H�
ߘ1�H�&��1��w�����`|��1�M��D�H�
̘H�M�1�M���kw��I�� L��I���+o���t�H��E1��Vo������H��L��E1�E1��}}��1ۅ��4�����{��H��I��M��I�‹1��L�T$ H���PH��H��H�D$ H��H�D$H��1���v��1�1�H��H�����v��H��L���}��AZA[��L�T$�V��������h{��1��H�
ڗD�H�މ1�A��sv��L���;n����H��H�=;�1��p��H��H��I���|��������E1�����{��H�
[�H���1�D��1�A��
v���&���z��1��H�
ŗD�(H���1���u��D��I�� I���Dp������jq��E1�1�E1����H�|$t�H�5�-H�=T�1�H�Q��Io���H��I���m����������L���m����u
E1�1�E1��_���L��H�=8�1�E1��n��L��E1�H��H���{�����2����X���L�d$H�\$�����y��1��H�
ߖD�(H���1��t��D��I�� I���^o����f���AWAVAUATUSH��XdH�%(H�D$H1�L�l$,H�D$8L�d$@L�t$0M��H��H�l$(L��L��H�D$H���s��H����H���$fDH�|$L��M��L��H����r��H��H��tzL�L$8�\$(H��1�L�|$0H�L$L�L$��w��SH�@�1�AWH�L$I���L�L$ 1��t��H�L$PXZH��t��D$,t�H���1�1���s���n���fDH�D$HdH+%(uH��X[]A\A]A^A_��\o��ff.����AUATUH����H���vp��H���$H�IN CERTIH3EH�-----BEGH3UH	�t[H�����I�ľ����L����x��H��H����1�1�1�H���)m��I��H��tQH���yu��L����j��L��]A\A]��H�FICATE--H9Eu��}---
u�H���y��I���f.����H�
��1�1�H�1���r���DL���1�1�H�
9}H�ҩA�g�r��L��1�H�
��6H�5�z��k��fDE1�]A\L��A]�@�s���H�
��1�1�H����E1��4r������ff.�@AUE1�ATUH��dH�%(H�D$1��O���H��H��t]�Ro��H����o��I��H��trH��H���7r��H��1ҾL���l��H�<$Hc��m��L��1ɺ�	I���rl��L����s��H���ri��H�D$dH+%(u0H��L��]A\A]�DH�
���1�1�H����Tq�����l��ff.�f�AWAVAUATUSH����N$H�nH�|$hH�t$pH��dH�%(H��$�1��L$H�NH�L$��m��H����q��H����H��I����s��H����H�=�+L���x���D$0���L�[L���s��L�hM���RH��{�
M�m0M���<A�}u�I�uH���s����t�I�mH�ƄH��u��H�m0H���n�}u�H�uH���Qs����t�H���o��H��I���:v��L��H��H�]'�M�uM����L�-c�H����fDM�v0M����A�~u�I�~L����r����t�H�5=�L���eq��H���H�pH���I�~@���j��I��H�����8��H�5��H���r�����H��&L���M�~M��u�M�0M����A�u�I�wH���Hr����tܺH�5ۅL���@������1�H�5��L���'������H�5��L���p��H����H�pH���uI�@��j��I��H���[�8tZ�Vu��L��H���l��H�D$�Au��H��M��H��I��1�H�|$����H�
э1�P1��_n��XZH�|$�%H��%L���L��L�-'��6q��H�XH��u�v�H�[0H���a�{u�H�sL���!q����tݺH�5��H���������1�H�5��H���������H�[H���%L�-Ȃ�f�H�[0H���
�{u�H�sL���p����t�H�
֌�1�1�H���qm���n@H�
ٌ�1�1�H����Lm���_���H�
��1�1��2m��1�H���d��H���1�1�1��m��H����d��L���as��1�H�=��E1��0T�1�H��1���H�D$`H�D$H�D$pH�����H�=P�D�`�j��H�T$H�=ݬH��D��I��1��Ef��L��I���Zd��L�� 1�H��z1��rl��L���Ji��H�|$hL��H���Z���I��H����L���d��H���d��L���d��1��c��1��c��H�|$`tH�\$`H�{��c��H�{��c��H����c��H��$�dH+%(��H���L��[]A\A]A^A_�H�
F��1�1�H���1��k�����H�
����1�1�H�c��k��L���n��L�-�"H�5h"H��L���Ul��H�D$(H���XH�|$(H�5c"L���3l��H��H����H�5�"L���l��H���H��H�����k��I��H����H���|q��H�����xbH�C�D$HE1�H�D$ H�D$`H�\$`H����H����1���j��H�D$H�|$�b��H�|$ �vb��H���1�1��j��1��Zb��L���q��H�n��1�1��mj���W���H���1�1��Sj��H�$��&���H�sH�=t!�Wm������H�[0H���2�{u���H�
c��1�1�H��~�i��H��1�1���i������1�H����1���i��1��a������H�D$hH�
'���H�5�tH�=d�L�@1��	���F���E1�1�1�H�
���H����ui��H�� L����4���1�M��H�
Ј�H��}�Gi��H�� L����N���E�nH�|$ �Ic��b��J��Mc�H�D$ ���1�H�A~��h��1���`���n���H�\$`D�t$HE�����\$H��{Hc���b��H�l$@E1�L�l$ H�D$L�d$8M��K�|��h��H��H���;H�����H��I��H���L���Ze���L��L��A����rn�����{H�D$N�4�I��L9�u�H�|$ L�d$8H�l$@�`��D�l$E���LL���Nm��I��H����L���
k��H�5pH��H�D$�i��H���<H�pH�D$ H���*H�L$�H�y@�c��I��H���H�L$H��H�y@�_��H�L$L�L$ H���;H��L����'d��I�}0H���+b������H�t$(L����`������E���A���AL���b��L���mn��L���m��D�%�E�����|$H��Hc|$HE1�H���Y`��L�l$H�D$I���f.�I��L9���	K�|��)�K��H��u�H�
ɅH�ʾ�1��f��1����d��D�l$HL�t$E1�DK�<�I���k^��E9��H�|$�L^��H���H
��DŽ$�HDŽ$�DŽ$�HDŽ$���t`H�l$L�l$E1�H��D�|$HL�%*|K�|����E��H��L��I��H�ž�1�1�I����e��H���]��E9��H�l$H�|$tH�D$�8��H��$�H��$�DŽ$�HDŽ$��	TH�D$H���"��$��D$L���&
H�D$H�D$H�l$(1ۅ��1�H��$�I��H�L$I��J�4 H�D$H�<�蚸������H�|$H��$�tJ�t&H�|$�cg�����H��$�J�&E1�D�ZE����H�\$ H�l$(�H��$�J�&I��D9z��L��H��HB�����L�h��u�H�����H���)h��L��H�����I���h��L��H��I����f��L�����/\��L���'\����u�H�\$ H��$�J�|&�\j��H�D$H��9�$�����H�D$H�D$9D$H�g
��$����DH�\$ �f�H�\$ �L�5��1�1�L�=��L��H�l$(E1�L���c��L��L���1�E1�����D$LH�D$XH�D$@H�D$��$�L��$���~%��M��H��I�\ DL��I�� ���L9�u�L���[����$�L��$���~%��M��H�RI�\�DL��I���D���L9�u�L����Z���t$0��t(�D$0H�L$@��I��H�\�I�?I���Z��L9�u�H�|$@�Z���L$L��~&�D$LH�L$X��I��H�\��I�?I���tZ��L9�u�H�|$X1��cZ��L���[Z��H�|$�QZ��L�D$1�1�H�
�H�½���`b��L�d$D�l$HfDI�<�H���Z��A9��H�|$�Z��H�|$��H�=��\I1�L��H��1��M��H�D$pH��I��H�
wH�=4�LD�H��M���pIE�1��\��I��H�D$`�����H�PH�pH�=��1���[��I��M��M��t'L��L��H�=�m1��E[��L��I���ZY��L���RY��H�=*xM���g��I��H��t'H��L��H�=m1��[��L��I���Y��L���Y��L���^��H�|$hL��H���,���I��H���]���L����X��H����X��L����X��1���X��1���X�����H�D$`H�=�H�p1��[��I���%���H�|$��f��H�D$H�\$H��$�H��$�H��H��$�H��H��$����H��tfL�5KI��1�1�L��H��v��p`��L��1�H�5�vE1��g���D$LE1�H�D$XH�D$@H�D$���H�|$H��$�H��$����H�D$H����D�u��$�E����D$xL�|$A�����H�D$@H�D$X�D$L�D$P�D$|����H�l$(�D$TE1��@I��D9�$��vH��$�K�DmI�?D�l$H��H�4��Ȳ����t�H��$�H�4D�NE����L�|$0E1�A������D$ ����L�l$8�pfD��uXH�jH�|$(H������b��H��H�����I���b��L��H��I���?a��L�����V��L���V����uD�t$ H��$�H�4I��D9v~$H�VK�vH�‹��u�H�4E��I��D9v�L�|$0L�l$8D�t$D�d$ ����D$xHcl$x��H�|$@H����W��I�?H�l�H�D$@�]d��H�E�D$ ��DI�I�I��D�d$|�D$TD9�$������@D�D$TE��t#�D$PI���D$P9D$H�	��$��3����D$LHc\$L�H�|$XH���_W��I�?H�\�H�D$X��c��H��E������H�=9���DH�\$1�H��1������H�����H�D$��H�
2��1�1�H���E1�E1��G]���D$LH�D$H�D$XH�D$@���H�L$�D$H1���L�9H�YL�l�DH�3H���^��H��L9�u�L��I����_��H��fDM��tSM���fDM�mM��t?M�uL���W��H��H���b����u�M��tL��L���_��L��I���_��H���@L���xW��H��M����	M����M�mM��t;M�uL���[_��H��H���a����u�M��tL��L���_��L��I���!W��H���L���`��A������H�
{��1�1�H�B�1���[��L���Z���4����|$xH�l$(E����H�\$@H�D$H�3H�8�^������L$xH�sH��L�+��HcщL$0H���T��HDŽ$�L��HDŽ$���H��H���#H��$�H�t$X�|$L�
8H�D$H����H��$�H�t$@�|$0��7H�D$H�����\��I��H���H�5��H���X^���T��I��H���uH��$�H��L��H����V���������H�
\y1�1�H�1���Z��H�D$H�5�H��$��V��H�5�H��$��V��H���NR��L���]��L����W��H�|$�V1�1�H�
y��H�C��6Z����|S��H��D��D$|�Ic�HcT$|L�<@H��$�I��L�4RL�I��H�PB�2�H�@J�|0�`��H�CH��$�J�D8J�|0��_��L�t$H�\$`H�CH�D$�#���H�|$H�l$(����L�5²�1�1�L�=BxL��L���wY��L��L���1�E1��r���H�D$`���@�D$LE1�E1�H�D$XH�D$@���H�5���1��(�����H�x�1�1�H��H�1�M����X��L�-�I�?��[��1�1�H���&Q��H��L�꾀I��I��1�1��X��L���R��M�M��u�L����V������H�\$XH�D$H�3H�8��Z�������l$LH�sH��L�+HcT$LH����Q���D$x�D$0����L�5w�1�1�L�%�L��E1�L���-X��L��L��1�E1��(����D$0H�D$H�D$XH�D$@H�D$�`�L�L$A����1�H��vH�2�1�H���W����$�������E1�E1�L�%nH��$�J�<8I���o�E��H��L��I��I�ž�1�1�A���nW��L���6O����$�A9�|��h���E1���H��l1��1��8W��1��O����1�1�H�
�v��H��k�W��H�YL�����L�5���1�1�L�=�uL��E1�L����V��L��L���1�E1��ս���D$0H�D$�(�H�8��1�1�L�mA�:H��H����V��I��H�
��6H�5�^1���O��H��k�1��SV��1��N�����H�
�t�1�1�H���+V��L�5�
H��$�L���4R��H��$�L���$R��H����M��H��tH�5ΰ�1���E1��S�1�H�
u��1�H���U��L����\���t�H�mk�1�1��U��H�D$I��H��I�>I���TM��I9�u�H�|$�EM��M��tL����P��L���\�����H�	��1�1��CU��H�D$�{�H�
�s�1�1�H���U�����L��k�1�1�A�RH�
'�H�(���T��L�t��_���L�t�1�1�H�ЫL��L�d$8H�l$@H���T��H�aj1�1��L���T��H�޿1�L��sL��蒻��L�l$D�t$H1�I�|�H���8L��A9����H�7��1�1�L�d$8H�l$@�?T���H�
�r�1�1�H�֭�!T��H�D$���H�Gi�1�1��S���]������H�
�r1�1�H�
����S��H�D$���H��$�L���:U��L���BO���������D$���D�D$1�1�H�
1rH�2���S��H�D$�������H�
r1�1�H�����QS��L�5�
H��$�L���ZO��H��$�L���JO��H���K��L���P��H�D$����L�5Er1�1��L��H�����R��L��1�A���H�5������/���H�T��1�1��R������1��*W��A���������1�H�
�q�1�H����R��1��P������H�Jh�1�1��bR�����H�q@L��L��1��L����1�H�"i�1��2R��1��I�����M�����AWAVI��AUATUSH���L�zdH�%(H��$�1�HDŽ$�HDŽ$�M���@E�'E���1�1�D�ᾀH��h�Q��A�O1�1�H��h���Q��A�O� ���u��1�H��hI��1��pQ��A�
��A�GH��mHc�H�>��I�OH�&i1�1�� �7Q���A�.���E�GA���H�-�A�_1��
H���}S��9��`H�=M�gA��L��^H�
iH���H���!L���U��H��H����$H��$�H��$�L�����H���L$M��H�
Bs1�1�H������mP��H�=�L���O���$�X�I��L��H�ŋ��E4�P�u�PV��L��H�E�DV��H�5�H�=�iH��H�D$1��I��H�|$I����G��L�mL����L��H��k� �E,����������&�H���C���I��H����%�EH���E8��
I��H���d&D�$M��L�FrE����*H�5a]L�Ǻ,1�H�
e���H�=�
L���N��H�����H�=miA�o�JM��L��I��H����H�=`�1�E1���H��L��H����F��H�� 1�H��]1��N��H����K��H��L��H�����H��H���/L���F��H���F���@H��$�H��$�L��舛��A�V0���LH��t?L��E1��<���@H��$�dH+%(��(H���D��[]A\A]A^A_�@H��$�I�~ H��$�H��$�H���tP��H��A���E��E���PE�'E���P���A��@I�~H�-y\H��腨��A��$������E�GA��
���D��H���Fu��������A��
�4H�ijJc�H�>����H��F��1�1�H�={�H��I��H�@I�F�~H��I�F ���DE�F41�H�
#r1�H������0M��L���ج�����H�
�o�1�1�H���M��E�GL�-�q�1�1�L��H�!����L��A�oH�����H�=�d��J���H�=�H����I��1��]F��L��H���rD��H�� 1�H�[1��L��H���bI��H��L��H���t���H���<D��E�GL�� D����o��1�H��I��A�F4P1�S�?L��I�~ AYAZH��t,�]D��I�F I�~��p��I�FH��������o���I�~�p��I�F�Y���M�fI�_L��H���m�������E�G����I�OH�$c1�1�� �K��A�O� 1�H�c1��K��I�O 1���H�c1��K��A�G(��������H�c�1�1��WK��I�O8H�c1�1�� �>K���	���I�OH��b1�1�� � K��I�O1���H��b1��K��A�G ���2���NH���� 1�1���J�����I�OH�0b1�1�� �J�����I�OH��b1�1�� �J���l���I�O1�1�H�{b��H�-nTH�xa�uJ��I�O1�1�H�`b� �\J��E�g H��H�Wb� E��HE�1�1��9J��E�o$H��H�Hb� E��HE�1�1��J�����A�O1�1�H�Fa���I��I�O� 1�H�9a1���I�����L��L�����H��@E�G� H�
hnD���@m��1�H�_�I��A�F4P1�S�I��I�~ ^AXH���U����]���H�=�M�g1�H�5.y���O��H�=zL���JN��H��H��t8E�I�~E����H�sI�~�ţ����tH�=BL����G������A�wH�=׬1��HC��H��H����E��H��L��H�����H��H���YH���@������A��������������H�=�I�o1�H�5mx���XN��H�=�H���M��I��H���bH�x �A��I�}�N��H�$A�E���E�����cL�MT���cA�wH�$1�1�H�
K]H�=��lB��H��H�=bI���:N��I��H��t'H��H��H�=&T1��A��H��I����?��L���?��L����D��L��L��H���Օ��H��H����#H�<$�?��1��?��L���?��H�����H�}�o?��H�}�f?��H�}�]?��H���U?�����A�G L�4$1ۉD$I�GH�D$f�H���(?��1�H�=�`1��O���Ń���L��$�A�M���f.�A)�I�E����
Ic�L�����$H��H��H����H���u��K��D�A��t�L�4$��D�$�EA��D�$�1�H�
�jH�/`1��F��L�D$H�
���_1�H�5H`H�=�j���1��X>��A�oH�����H�=;`�D���H�=��H����I��1��@��L��H���>��H�� 1�H��T1��3F��H���C��H��L��H������H��H���1���H�
Zj�1�1�H����E������H��$�H��$�DŽ$�HDŽ$��44I��H���A�wH�=ժ1�L�%�Q��?����$�H�$H�Ņ��LL�|$I��L�t$H�$H��$�H�=
�M��H��H�H�pH�1��?��H��H��t#H��L��L��1���>��L��I���<��H����<��H��$�H�D�zE��~vE1�L��H��HB�������KH�pH�=^1��?��I��M��t&L��L��L��1��s>��L��H���<��L��I���}<��H��$�I��H�D9j�H�=�]1�M����>��H��H��t#H��L��L��1��>��L��I���4<��H���,<��H�$H�$9�$�����L�|$L�t$L��H�=>^1��k>��I��H��t*H��H��H�=7P1��=��H��H����;��L��H����;����$�L��$���~ ��L��H��M�l H��H�� �{���L9�u�L���;��H���@��H��L��H��訑��H��H�������H�
�g�I�H��$�H��$��G���I��H���2A�oH�����H�=/\�dA��L��H�=��H����I��1���<��L��H���;��H�� 1�H��Q1��C��H����?��H��L��H������H�
�fH��H������H�h��1�1���B�����A�GM�gL��$�H��$�L��I�o �D$|�D$(I�FL��HDŽ$�H�D$0HDŽ$����H����M��H�
�e1�1�H��Z���YB��H�D$A�oH�����H�=�Z�I@��H�T$H�=e�H����I��1���;��L��H����9��H�� 1�H��P1��A��H����>��H��L��H�����H��H�������H�
"e�1�1�H���A������I�FI�M�oHDŽ$�H�D$ A�G H�|$�D$(DŽ$�HDŽ$��������M���L�����H��H����(9��H�|$H��$�H��$��>���H�D$H�����|$(D��$���1�E����L�t$8H��E��L�|$0�D��$�H��A9��ZL��$�H�,[L��\$H��M�$/I�4$�'�����t�H�l$PL��L��E��EL�|$0L�t$8���
L�l$8E1�L�t$0H�\$@L��D�d$HI��I�D$H�,[M�w(��H��H�H�x�A9G ��	���~I��H��L�l$8L��H�\$@L�t$0D�d$H�L$@L�D$8H�T$0��7��H�EH�T$0H�|��7���EH�T$0L�D$8�L$@���E��)�H�}I�pLc�Hk�HuMk�H�L���19���}�mH��$�H��$��.H�D$0H������$�L��$��D$�����|$(�����HcD$L�t$(E1�M��H�D$8��I��L9d$8�L��$�L��L��D�d$@H��L�H�u膒����tʋE��~�L�l$HM��1�M��H�EH��M�o(��H��H�H�x�A9G �����rM��L�t$(M��L�T$8�L$(H�$�6���EH�$�L$(L�T$8���E��)�H�}H�sL�$H�H��HuH��H�H����7���}����$��$L��$��D$D�D$�$M��H��$���$�H�|$�z���H��H���TH�=g��R%H�L$ H�T$�H��1��9���A� H�
�TtI�O(H�PaH�5���1��ݤ����$�H��$���~ ��I��H�@H�\�L��I����`��L9�u�H���b5����$�H��$���~ ��I��H��H�\ L��I�� ����L9�u�H���'5��H�|$��H�|$0��A�wH�=��1��m7��H��H���:��H��L��H������H��H���(�H�
�`�1�1�H����<����A�wH��QH�=�1��7��H��H���9��H��L��H��赊��H��H���MH���q4��1��j4�����H��
1��?��E�G�1�A��H�
Q_H�Ҝ1��c<��H�����H�=�A�o�\:���	I��H����@���6������L���C��H�t$H�=�UH��H��1��5��H��I��H����3��M���H�=��L����@��H���s�0L�4$�5��H�|$L� H����A��H�{ H�C�(4���D$�C����H�3H�=��H���?��D�-��E���;
1��?3��H�;�A��A�wH�=��I��H��1��5��L��H���3��������@��L�4$D��G����?���1�L�4$D�H�
_H��1��:���>�H��9]���L�l$HM�����f�H��$�H�
�_H�:�1��L�@1��:��H��$��7��L���C�����H�o��1�1��y:���D�A�oH�����H�=wT��h8���H�=�zL�-�^H����I��1���3��L��H���1��H�� 1�H��H1��:������>���1�L�4$D�H�
^H�tS1���9���,�H���AH��� ��H��H���-�1��H��$�L��L��輄��H�D$H���N�����$�H��$�1�A���������L�d$D��M��L�t$ I�����$�I��D9���H��$�K�vH��D�t$L�<�I�7覌����t�E�GE���eL�t$@1�fDI�WH�[M�l$0A�t$(H��H�x;0������M��L�t$ L�d$L��O��tM�G0L�-�[1�M��1�L��H�q����8���|$(����H��$�H�|$|�'�L$|�D$1����0L�l$L��M��I��L�t$H���D�D$|H��D��A9���I��L��I��L�$�I�7褋����t�A�O1҅��&L�d$ I��H�l$8L��I�m0A�u(H��IGH�x;0�����eL��L�t$M��L�l$L�L��N��tM�G0L��H���1�1����7����$�H�D$H��$�����D�,$I��@L��A��I���Z��A9�|�H���;/���D$(����H�|$����A�wH�=�1��1��H���>���f�H��A9_�
���L�t$@�\$���I��E9w��L�d$ H�l$8I�H���P9���������A�GI����A�GHc��l0��IcWI�GA�M(H���L�IcGI�WI�}0H��L�|��<���D$I�G�*���DH��A9\$����L�t$0��$�H�D$0���H�������9��L��H�����I����9��L��H��I���8��L���D$8�-��L����-���D$8�����M��L�t$ L�d$A�w(����DL��A�����A��H�k��1�1�L��@H��H��l�5��I��H�
Rl�6H�5�=1��.��H�
hY1�1��H�0��5��A�oH�����H�=�N�|3��L��H�=�uH����I��1��/��L��H���-��H�� 1�H��C1��05���m�E�gH�����H�=�N�$3���
H�=@uH��D��H��1��.��H��I���,��L�� 1�H�]C1���4��L���1��L��L��H��迂��H��H����1��|,��1��u,��L���m,��E�G� H�
=YD���X��H�6�1�I��A�F4P1�j�k4��I�~ XZH����,��I�F I�~�Y��I�F�%�A�wH�=V�1��g.��H�ŋ�$����ML�<$1�L�t$H��$�H�[H�=�LI��L�$�H�4�1��!.��I��H��t'H��H��H�=�?1��u-��H��I���+��L���+��H��$�L�B��~~1�H�RH�DmH�‹��������H�PH�pH�=W�1��-��I��M��t*L��L��H�=t?1��,��L��I���+��L��M���+��H��$�H��L�9j�H�="L1�L���Q-��I��H��t'H��L��H�=?1��,��L��H���*��L���*��H��9�$�����L�<$L�t$H�=�L1��,��I��H��t*H��H��H�=�>1��N,��H��H���c*��L��H���X*����$�L��$���~ ��L��H�@M�l�H��H���U��I9�u�L���*���0�H�D$A�oH�����H�=�J�80��H�T$H�=TrH����I��1��+��L��H����)��H�� 1�H�r@1���1����I�O0H�gI� 1���1���r�I�O(H�KI� 1��1���}�A����A�d���H�D$�9�L�D$H�
�TH�?1���j1��H�D$����H�
eT�1�1�H�Փ�@1����=5�1�H�5La����3���!����E�oH�=-��HH��M��1�H��D��1��3���H��E�GI��ATH�
_S�1�H�q�1���0��A[E�G[��H�QH� 1�1��0���M�H�7H� 1�1��0���Z��M�FH�
�1��5H�5r;H�=�T�Ց����H�����H�T$`L�D$X�\$l��3��L��H�����I����3��L��H��I���2��L��D$P��'��L����'���D$PL�D$XH�T$`�L$l������H�EM��M��L�t$(H�|��A��L��?H�
�H��f�1�1��/��L�?���H�
�R�1�1�H�{��/����H������3��H��H�����I���3��L��H��H���1��L��D$@�!'��H���'���D$@���)���L��M��L�t$L�l$A�w(�F���@1�M�FH�
��1��H�5:H�=nS�i���L�,$�'�H�pH�=�1��)��I���q���H�=�G1��)��I������ �(��H�CI�(H����4��H�EH�kA�G0�EI�8�4��H�EI�@�4��H�E���L�]:�!�H�������+���H��L��G1�A��H��H�oe��-.��I���l���� �k'��H��I�EH�8�,4��H�EI�]�C�EH�{�4��H�EH�{�4��H�$L��9H�
�BH�EA�wH�=��1��(��H�uH�=E�I��1���'��L��I��H��t'H��L��H�=�91��<'��L��H���Q%��L���I%��D�eH�UE���gH�uH�=E�1��'��I��I��M��t'L��H��H�=_91���&��H��I���$��L����$��H�=GL���53��I��H�����H��L��H�=91��&��L��H���$��L���$����I�~�Q��I�F���H������\$`�W0��L��H�����I���E0��L��H��I���.��L��D$X�[$��L���S$���D$X�L$`�����H��L��I��L�l$8H�EH�\$@L�t$0D�d$HH�|� ��H�{�W2��I��H�{@�$��A�wL��1�H�={��V&��H�������$�H��$����d�H���#����H��$�H��$�L���2����$�o��H���#���D$|L��$���~ ��L��H��I�l H��H�� �C���H9�u�L���V#���"�L�|$0L�t$8H�D$��H��$�E����1�L��� D��$�H��D��A9����H��$�H�[�\$H�4�H��L�,��~����t�H��$�L��I��H��H�<H�|$0�"N��A�D$�;D$H�|$0��$��+D$H�t+Hc�Hk��2$����H�D$�p���Lc�M��L�t$ L�d$H��$���A�����K�Dm�H�NjCH�{���CHc��$��HcSH�CH�RH�\��A�G(�I�0�h0��H�CI�8�[0��H�C�t$(L�-\M�����D�D$|L��$��L$(L��H��$���$��L���H�D$H��trL��H�YB1�1����)����$�H��$����0��K�A�H���`���1�1�H�
ELH�����)��H���:��H������H�=Ɍ�H�L$0L��H��1�蝡��A�(H�
T@tI�O0L��H�5��1��E����V���H�}�G/��A�H�=J�L��6I��H�
OA�H�5`H���7���L����-��H���LA�L��6H�
�����1�H�
1L�1�H�$A�(��H�\$0��$����H��$�M��E1�1ɋ�$�H�|$�̡��H��H��u�H�=���H�L$ H�T$�H��1�菠���|$(�K�1�H��K�H�5׌�:�����$��X���$�L�t$(L��$��D$��H��H�='�1��0"��I������K�Hc�L$�t!��H��H��H��$�Hc�Hk�H���-���C�H��� ���L$H�CI�ʼn�$�A�G(A�EI�0�-��I�EI�8�-��I�E�2����|$M��L��L�t$L�l$I���,���D�AH��$�� �L$Ic�D�D$�� ��H��H��$�H��HcD$H��H��*-��L��H��-���C�H�C�: ��H�CA�W(�I�0H�[��,��D�D$H�CD�D$|���D���N�HcD$����H�D$(E1���I��L9d$(��L��$�L��L��D��H��I�I�2L�T$8��y��L�T$8��t�I�rH�|$�(����u�L��$�M�dL������D$����$�9��4)�I�t L��Hc�H������$��$�L��$��D$D�D$�$M��H��$���$�H�|$�"���H��H�������H�=��H�L$ H�T$�H��1�����X����7!��L��H���+��H�=��H��H���z)���=o��9����=_�1�H�5�U���'���K�����A��H��D��$��fH���D$A9�|fD��H��)�H�D$PHc�Hk�H�t����S�A�XL�-H�
�=�&���L��H�
��01�H�5�2�d���H���|����v��A��
L��,H�
P=����y����$�H�D$0H��$����
�H���Q��H�D$0H�D$�3�\$H�����$������D$@9�|bL�$)�I�t$H��Hc�H��L�H�������$��$L��$��D$���A��L�$,H�
�<�0�L�,$���A��
L�,H�
{<��L�4$������=U��ATA�tD��A\�D1Ҿ�(�� ��A�ă��t'A������D��A\��(�f.�H�
���1�1�H�I���������J#������AWAVAUI��ATE1�USH��H���M�eE1�H��L��[]A\A]A^A_�@A��H����"��H�
��H���I��H����A�F�L�|�f�H�;����H��H����H��L���1#����tmH��L9�u�L���L*��A9��v���L��6�1�1�H�
�H��YA�V�j"��L��1�H�
�X�6H�5�*���f��[���H�����H�
<�H�e��1�1�A��"��H�5j�L���"�����DH�
��1�1�H��{A���!����@��ATH�=�L�%��USH��dH�%(H�D$1�H�$�'��1�L�� I��H�
�H��1��{!���'��1�H��H��H��H���s!����t/��5(��H�XH�(H�T$dH+%(uDH��[]A\�DH�$I��L�ᾀH�ʊ1�L�H1��
!��H�<$����H�$����D��AWAVI��AUATUSH��8H�<$H�t$dH�%(H��$(1��D$,H�D$`����H���H�<$�1M�����Y���A�Ņ�u,H��$(dH+%(��H��8D��[]A\A]A^A_�1����AL���(���D$�����|$��'&�������D$��D$hH�|$`�'"�������|$dHcú��|�h1��r�������$��A�ʼnŃ���������|$d�%��H�t$@1�D���f#���D$@A��A��u�������H�\$,��,� �|$`�H��� �����H��u
�'$���8t��D$,�|$`���t����|$d���t����|$,��M��tL��������#���T$,��|$�r��E1�|$,A���o����D$����1�����H�l$@1�1���H��Hc�H�D$XA�H�D$PL��$�H�D$HH�D$@�Y ��H��1ҿ�J ��H��1ҿ�; ��H��$�HDŽ$�L�����D��1�H��DŽ$A������A��Buʿ���D�`�A��~9H�T$h�1�fDD9$�tH��H9�u�D��H�T$�l��H�T$A��A��u�L�d$0�	L���k����� H�����1�H��������������Y"����������T1��q"��M���}�������H�5��H�=���;�������� H�5��H�=����������"��H�
�H���1�D��1�D�D$,� ��H�D$`���������!��H�
�H���1�D��1�D�D$,��������!��D�D$d�1�D�H�
��H�:�1�D�L$,����g���A��E��H�
��1�H�{��1�����@����U!��M��1�D�H��H�
N�1�H�u�E1�D�L$,�X���D$,�|$��������H�=L-�x#������1�L�%��� ��1�L��1���#���Ń��t��1��e�����n���L��1��#���Ń��t����<�����0�����9��M��tw�|$����!��H�l$p� H�5�Hc�H��1����Hc؅����|$1��������|$H��H���x ��H9����|$�F�����HH�t$H�<$���������� ��L�%
�L�$H���D�H��L��D�L$,1�1������|$dH�t$,�� ��H�����������H�
��H�$�1�D��1�����1���H�D$8L��	H�D$0�,�������b��M��1�D�H��H�
[�1�H�R�E1�D�L$,�e���D$,�����A��H�
0�1�1�H�M���;�������H�5l�H�=������`���R�T$4A��H�
��1�1�RL�D$H�$�����Y^����|$dH�t$,��D$,����H���������D�L$,H�
��D�H�h��1�1��������0���[��L�%d�M��H���D�H��L��D�L$,�V����2��L�%;�M��H�Q�D�H��L��D�L$,�-����	��H�
�H�ÄD��1�1�����/���D�L$,D�L���V�������L�%ًM��H�O�D�H��L��D�L$,�������H�
��H�1�D��@��AVAUATUH��SH��dH�%(H��$�������ZH����H�57�H��L�%��������tTA�L�'!H�
�H��O�1�1��;��L�Ĉ1�H�
�N�6H�5X �z��f.��}(u�H���)H������H��t��)H������L�hH)�H��H����I�湀H��H��L��I�����L������������H���H��H�8H��t(H�5� �l��H��tH�8H��tL���W��H��LE�L���8��H��$�dH+%(uoH�ĐL��[]A\A]A^�f�1�H�5�l��H�=���K�����fDA�(L��H�
������1�H�5gl��H�=@�����?����q�����AWAVAUATUSH��H�$H��Xf�dH�%(H��$H1�I��I����I�I��H�t$ H��$PH�H���D$�����D$����)�$@�H�L���	�����!L�L$PM��H�
��H��I������D$8%�M���,=�tuH�=Ni�9���L��L��1�H��1��'���M��H�
-�H����1�1�A�����H��$HdH+%(�H��XL��[]A\A]A^A_�fDH�L$L�D$L��L�纀薉��I��H���r1�L��1��.��A�Ņ������M��H�
��H���D��1�1�A��&���_������A�����H���1��A��M��H�
I�H���P1�����^_�!���=���H�=�h�	���L��1�H��1����M��H�
�H�������@H��$���������H�\$PH��$�H9���D�L$8��$�A9��D�L$<��$��L$A9��sA9��jD�L$@��$��L$A9���A9��������u9H��$@�L��H���&��H����L��H���B�����H�\$PH�{�
��H�D$I��H��u#�f.���H�I�H)���H��L��D�������y��U��M��1�D�H�
��1�H��A��]��H�|$�#���fDH�L$L�D$��L��H�5�!�J���I��H�������H�=�]�R���L��1�H��1��C����<���fDH�=y^�,���L��L��1�H��1���������DQM��H�
�RH����1�1�A����ZYD���
������f.�H��A��M��RH�
΄H���D�;��H��A��M��H�
��H�8�P�fDH��M��H�
��RH���p���DQM��H�
m�RH���S���H�D$E1�H�EH�D$PI��P�������H�
;�H��1�D��1�A������!���M��I��H�
�1�H���1�A�������6
��fD��AW1�AVE1�AUATI��USH��H��HdH�%(H�D$81��H�T$ H�=��H�1�H�D$H�D$H�D$ H�D$(�?��H�5@�H��"H�=�"I��1��
���H��H���	����uT�D$$A�$H�D$(E1�H�L���	��H�����L�����H�D$8dH+%(��H��HL��[]A\A]A^A_�H�L$H�T$1�H�����L�t$H��u�H�T$H�L$L��L��������q���H�D$I��1�H�
��H��LL�H1��5��H�|$�
���D$$L�|$(��~'��L��H��M�d �H��H�� 謃��L9�u�L��A�����������ff.�@��USH��dH�%(H�D$1�H�$H��tiH���H��H��H��������u5H�$H��t,L�JI��H�
��1�H�"~���h��H�<$�O����H�T$dH+%(uSH��[]�fDL�>��H�
D�A��H�XF���L��1�H�
�E�6H�58�Z���
��D��USH��dH�%(H�D$1�H�$H��tiH���H��H��H���&����u5H�$H��t,L�JI��H�
ˀ1�H�j}�����H�<$�o����H�T$dH+%(uSH��[]�fDL�^�H�
dA��H�xE�;��L��~1�H�
�D�6H�5X�z���	��D��ATUSH��dH�%(H�D$1�H�$H��tGH��H��H��H��H���
��I��H��tqL�����H�D$dH+%(��H��L��[]A\�L��~�H�
�~A��H��D�{
��L�~1�H�
D�6H�5����H�$H��t�L�HI��H�
c1�H�2|��1��.
��H�<$�
��H���=��I���R��������AW�H�52~AVAUL�-CATL��US��H��XdH�%(H�D$H1�H�W�H�8����a���u���l�*��D$��t&H�D$HdH+%(��H��X[]A\A]A^A_�H���L��H�5�}H�8�����t�H�=�}�r��L��H�5�}I��H��H���H�8�#���H�
�~H��}1�I����I��1����L�������@�O���@$H�x0I���\��M����E1�1�1�H�����L���-��I�D$H���
L�����H�8�L��
H�5a}H�8�����
H�5W}��D�L��A�D$ H���H�8�y���H�H��I�D$L��H�=�=��L�5\}�
��H���L��L��H�5J}H�8����L��H��I�������������|M��L�
!|H� � ME�H�
|��HD�L�N1�H�Mz1���
��L�����H�G�H�t$ H�D$0L�+L�����D�D$ L�K1�H�D$H�
}H�0z1�� �|
��D�D$ E����H�D$(H�\$L�d$0H�D$L�5Y|�N�L�HL�H�
�|1�H�	z�1��-
��H�|$0���H�D$0�D$H���D$;D$ �+H�H��{1�1�� ��	��H�T$H�3L��L���(��I��H�D$0H���w����|$(1�~cH�\$L��I��f�H�D$J��L��L��H�0����H��H����J��1�I��L�� 1��u	��H���=��I��D9|$(�I��H�\$L�������3���DL�d$0�H�D$0H�D$8L�����H�|$8�d���L��H�D$0����������tP�L$0H�6z1�1�� �����+����1�H�
O{� 1�H��z���H�|$�2�������x
��D� D���-��D�� 1�I��H��w1��������DH�5KzL���)����u�������@���H�5�L�������t�M��H�
�z1�1�H�|w����|������H�D$0H���p���N��RH�
qz��pH�D$H��w1�L�1�����H�|$@���H�D$@Y^�J����R���ZH�5�H�=Ly�jy��������H��H���UNKNOWNSESSIONCONNECTADDALIASREMOVEALIASQUERYALIASESQUERYMAPPEDALIASESCREATETICKETVALIDATETICKETREVOKETICKETVALIDATE_SAML_BEARER_TOKENINVALID../serviceImpl/alias.clist../common/VGAuthUtil.cserviceclockSkewAdjustmentallowUnrelatedCertslistenTTLticketticketTTL%s: Failed to open file "%s"
%s: Opening file "%s"
../common/i18n.ccatalogwfileLogger.cdata != NULL%s.%d%s: chmod() failed, %d
signalSource.cnbytes == sizeof infoinfo.si_signo < MAX_SIGNALSVGAuthService<null>errorcriticalwarningmessagedebugunknownno time%FT%T%s.%03dZ[%s] [%8s] [%s] %s
Unable to open log file %s
FALSEuserAliasesaliaspemCertificatealiasInfosaliasInfosubjectanySubjectcommentmappingsmappingsubjectsuserNamerequestNamesequenceNumberversionaddMappedLinkpemCertpidtokensamlTokenvalidateOnlyhostVerifieduserHandleInfouserHandleTypesamlInfosamlSubject../serviceImpl/proto.cSessionRequestFound username in req type %dFound ticket in req type %dFound SUBJECT in req type %dFound comment in req type %dFound pemCert in req type %dFound pid in req type %dFound token in req type %dnamePasswordsspisamlsamlInfoOnlyinfosuser-%s/%s%s%s%s: EOF on socket
%s: send() failed, errno %d
<NO CERT SUBJECT>%s: allowing error %d
samlSchemaDirschemas..catalog.xmlsaml-schema-assertion-2.0.xsdProcessing SIGHUP

--msgState == NULL%s: socket() failed, %d
%s: bind(%s) failed, %d
%s: stat(%s) failed, %d
%s: chmod(%s) failed, %d
%s: chown(%s) failed, %d
%s: fcntl() failed, %d
%s: listen() failed, %d
<>/\%s: Illegal user name '%s'
g_mkstemp(%s) failed../serviceImpl/filePosix.c../serviceImpl/service.cstopListeningIOFuncg_unlink(%s) failed../serviceImpl/file.cpCount%s: condition: %d
parent%s: accept() failed, %d
rootReturning error message '%s'
gio.cguest.log.text%s [vgauthservice] %s%s: socket() failed %d
%s: bind() failed %d
%s: connect() failed %d
%s: reply len: %u
%s: reply len too small (%u)
%s: unexpected EOF, failing
disabled%s: RPC unknown or disabled
Unknown commandXML Error: %s<UNSET>%s: about to stop main loop
%s END SERVICEis not yet validhas expired../serviceImpl/netPosix.csocketDir != NULL%s.ANY-k%s bad pid %d read; skipping
-s-b%s: failed to daemonize
-hUsage: %s [OPTION]
	-s	Run in daemon mode.%s: unrecognized args
auditingauditSuccessEvents/etc/vmware-toolslocalizationmsgCatalogLANGC%s: user locale=%s
/%s%smessages%s%s%s%s.vmsglocalPath != NULLUnable to open '%s': %s
bufmyValueINIT SERVICE
build-22544099%s %s starting upallowSymlinksaliasStoreDir%s/%smapping.xmlsuffix%s.badFailed to load schemas
xmlSecInit() failed %d
xmlSecCryptoInit() failed %d
listenConnectionMap == NULLmaxDataConnectionsPerUserdataConnectionMap == NULLBEGIN SERVICE
%s: main loop has exited%s/%sXXXXXX%s: fdopen() failed
(0 == num) || (NULL != aList)%s: fputs() failed
<userAliases>
</userAliases>
   </aliasInfos>
</alias>
%s: fflush() failed
%s: fsync() failed
%s: fclose() failed
%s: chown() failed, %d
<mappings>
</mappings>
    </subjects>
  </mapping>
      <anySubject/>
      <subject>%s</subject>
%s.bak%s: trying to restore files
%s: failed to restore %s
SSL error data: %s
../common/certverify.c-----BEGIN CERTIFICATE-----
NameIDSubjectConfirmationMethod%s: method %s not bearer
SubjectConfirmationDataNotOnOrAfterRecipient%s: failed recipient check
Conditions%s: Time Conditions failed!
ConditionFailed to verify Conditions
Missing signature node
Missing KeyInfo node
Missing x509 node
Failed to create key managerFailed to init key manager
PEM cert: %s
Failed to register ID
Signature verify failed
Failed to verify Signature
%s: Token chain cert #%d:
%s%s: User '%s' doesn't exist
%s: User doesn't exist
%s: Store chain cert #%d:
%s../serviceImpl/verify.cvalidateSamlToken failed</samlInfo></reply>NotBeforeNo Subject node found
Failed to parse document
TRUE<ANY>complete: %d
sequenceNumber: %d
requestType: %d(%s REQ)
version #: %d
userName: '%s'
userName: %s
addMapped: %d
pemCert: %s
Subject: %s
ANY Subject
*** UNKNOWN Subject type ***
comment: %s
userName '%s'
ticket '%s'
token '%s'
username '%s'
validate Only '%s'
hostVerified '%s'
Security check failedlistenConnectionMap%s: no such user '%s'
%s: failed to save Aliases
addAlias failedidx <= nummaList[userIdIdx].num >= 0removeAlias failedqueryAliases failed<alias><pemCert>%s</pemCert></alias>queryMappedIds failed<anySubject/><subject>%s</subject></subjects></mappedAliases>/dev/urandom%s: read error: %d
%s: Failed to close: %d
Ticket-%s-%s../serviceImpl/ticket.ccreateTicket failedvalidateTicket failed</samlInfo></userHandleInfo></reply>Unrecognized requestsessionRequest failedConnectAddAliasRemoveAliasQueryAliasesQueryMappedAliasesCreateTicketValidateTicketRevokeTicketValidateSamlBToken	�����	�� 	��`	��p	���	���	��@	��P	��0	��
��%
��
��<
��d
��
��
���
��
��
��
�����������������h��x��x��x��������t��T��T��d��d��T�������������������|!���!��0!��0!��0!��0!��0!��0!��0!���!��0!��0!��0!��0!��0!��0!���!��0!��\!��%���$���$���$���$���$���$���$���$���$���$���$���$���$���$���$���$���$���$���$���$���$��S)���%��8&���(���(���(���'��(��8(���%��`(��P&���&���%���&��'���%���'���%��8'��h'��&��*���&��*��f%��f%��f%��*��f%��*��*���&��֨��S���4�������+�������4�������������Ș��Ĩ��!���Q���c�����������H�������w�������^���CreateVMCISocketVMXRPC_SendRpcSendLogStringVMXLog_LogVUsercheckLookupUidUsercheckLookupUserCertVerifyX509ToStringCertStringToX509VerifyCallbackServiceInitTicketPrefsServiceInitListenConnectionPrefsServiceListenHashRemoveCheckCheckTimeAttrLoadPrefsLoadCatalogAndSchemaUserXmlFileOpenCertVerify_CertChainServiceVerifyAndCheckTrustCertChainForSubjectCertVerify_CheckForUnrelatedCertsBuildCertChainVerifySignatureVerifyConditionsCheckAudienceVerifySubjectSAML_VerifyBearerTokenAndChainServiceProtoValidateSamlBearerTokenProto_FreeRequestServiceNetworkListenServiceNetworkWriteDataServiceNetworkReadDataServiceNetworkCreateSocketDirServiceFileVerifyFileOwnerAndPermsServiceFilePosixMakeTempfileServiceAliasQueryAliasesAliasDumpAliasesServiceFileSetOwnerServiceFileCopyOwnershipAliasDumpMappedAliasesFileAliasSafeRenameFilesServiceFileUnlinkFileAliasSaveAliasesAndMappedAliasLoadAliasesServiceNetworkAcceptConnectionServiceReplyTooManyConnectionsServiceIOAcceptGSourceServiceIOAcceptProto_SecurityCheckRequestServiceCreateUserConnectionServiceStartUserConnectionServiceProtoHandleSessionRequestServiceProtoHandleConnectionServiceAliasAddAliasServiceProtoAddAliasServiceAliasRemoveAliasServiceProtoRemoveAliasServiceProtoQueryAliasesServiceAliasQueryMappedAliasesServiceProtoQueryMappedAliasesServiceRandomBytesServiceCreateTicketInfoServiceProtoCreateTicketServiceProtoValidateTicketServiceProtoRevokeTicketServiceProtoDispatchRequestServiceProtoReadAndProcessRequestServiceEndMainLoopServiceFileSetPermissionsServiceFileLoggerOpenServiceSuicideMsgLoadCatalogMsgGetUserLanguageI18n_BindTextDomainServiceIDVerifyStoreContentsServiceValidateAliasesServiceFileRenameFileServiceFileMakeDirTreeServiceAliasInitAliasStoreSAML_InitServiceInitDataConnectionPrefsUtil_AssertServiceCreatePublicConnectionServiceIOMainLoopServiceStartAndRunmain%s: trying to free unknown request type %d
Assertion '%s' failed at %s:%d
%s: Allowing %d of clock skew for SAML date validation
listenTTL set to invalid value of %d, using default of %d instead
%s: listen conn TTL set to %d seconds
%s: computed reapCheckTime as %d seconds
ticketTTL set to invalid value of %d, using default of %d instead
%s: ticket TTL set to %d seconds
%s: Incoming file name is "%s"
%s: failed to dup stderr to logfile
%s: removing old listen conn for user %s
Signal source: reading from wake up fd failed.Too many signals queued, this shouldn't happen.
Could not queue signal %d (error %d: %s)
Unexpected element '%s' in parse state %dBad parse state, popping aliasInfo in req type %dBad parse state, popping pemCert in req type %dBad parse state, popping (any)subject state %dBad parse state, popping unknown parse state %dTrying to handle new request of type %s when processing a request of type %dFound version number in req type %dFound addMappedLink in req type %dFound ANYSUBJECT in req type %dFound SAML token in req type %dFound validateOnly option in req type %dFound hostVerified option in req type %dFound userHandle type in req type %dFound unrecognized userHandle type %sFound samlSubject in req type %dUnexpected contents '%s' in parse state %d%s: Unable to parse contents of '%s': %s
%s: error %d reading from socket
%s: asked to send %d bytes; bad caller?
%s: name: %s ok: %d error '%s' (%d) at %d depth lookup:%s
%s: error '%s' (%d) treated as failure
%s: Using '%s' for SAML schemas
Error: catalog file not found at "%s"
Error: Failed to load catalog at "%s"
Failed to create schema parser context
Error: Failed to parse schemas
Failed to create schema validation context
%s: getpwnam_r(%s) failed %d (%d), try #%d
%s: unlink(%s) failed, %d - continuing
%s: failed to get uid/gid for user '%s'
%s: getpwuid_r(%d) failed %d (%d), try #%d
%s: failed to load Aliases for '%s'
[function %s, file %s, line %d], %s, [errno = %d], %s
Failed to change ownership of %s[function %s, file %s, line %d], %s
%s: got new connection on '%s', sock %d
The user exceeded its max number of connections<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber><errorCode>%Lu</errorCode><errorMsg>%s</errorMsg></reply>User %s exceeding concurrent connection limit of %d connections (connection ID is %d)Established a new pipe connection %d on %s%s: couldn't get VMCI address family
%s: failed to create VMCI socket
%s: failed to build RPC packet
%s: failed to send packet (%d)
%s: failed to read reply length (wanted %d, got %d) (%d)
%s: failed to read reply  packet (%d)
%s: failed to send RPC packet
%s: Error sending RPC, assume they aren't supported
%s: new RPC Failed, using old
XMLSec Error: %s:%s(line %d) object %s subject %s reason: %d, msg: %sProcessing SIGTERM; service exiting
%s: Could not parse %s value (%s).
%s: FAILED SAML assertion (timeStamp %s, delta %d) %s.
signum != SIGKILL && signum != SIGSTOPCannot set signal handler: %s
%s: g_lstat() failed on '%s', %d
%s: Unable to look up userinfo of '%s' to check ownership of '%s'
%s: Unable to look up userinfo of '%s' to check ownership of '%s', but found valid entry for uid %d
%s: username '%s' lookup failed, but found uid %d -- temp NIS outage?
%s: failed to look up uid %d; assuming user is deleted or NIS is inaccessible
%s: uid mismatch for %s (want %d, found %d)
%s: gid mismatch for %s (want %d, found %d)
%s: file permission mismatch for %s (want 0%o, found 0%o)
/var/run/vmware/guestServicePipe%s: socket dir path '%s' already exists as a non-directory; canceling
%s: g_mkdir_with_parents(%s, 0%o) failed (%d)
%s: failed to create socket dir '%s' error: %d
%s: Created socket directory '%s'
/var/run/vmware/vgauthsvclog_pid.txt%s: failed to open pid file '%s', error %u
%s: sending SIGTERM to service at pid %d
%s: pid %d not found, returning success
%s: kill(%d) failed, error %u
Service to support SAML token and ticketing authentication for VMware products.
	-k	Shut down the running instance that was started as a daemon.	-b	Run in background mode, using a pid lock file.	-h	Display this help and exit.%s: Using LANG override of '%s'
%s: loading message catalog '%s'
Unable to read a line from '%s': %s
Invalid UTF-8 string in message catalog (key = %s)
Cannot load message catalog for domain '%s', language '%s', catalog dir '%s'.
/var/lib/vmware/VGAuth/aliasStoreUsing '%s' for alias store root directory
@&!*@*@(alias.dir.badperm)Alias store directory '%s' has incorrect owner or permissions.  Any Aliases currently stored in '%s' will not be available for authentication%s: failed to open alias store %s: %s
@&!*@*@(alias.mapfile.badperm)Alias store mapping file '%s' has incorrect owner or permissions.  The Aliases in the mapping file will not be available for authentication@&!*@*@(alias.alias.badperm)Alias store '%s' has incorrect owner or permissions.  The Aliases for user '%s' will not be available for authentication%s: g_rename(%s, %s) failed (%d)
@&!*@*@(alias.alias.renamefail)Failed to rename suspect Alias store '%s' to '%s'@&!*@*@(alias.alias.rename)Suspect Alias store '%s' renamed to '%s'%s: alias store had invalid contents
@&!*@*@(alias.dir.notadir)Alias store directory '%s' exists but is not a directory%s: Failed to load alias for user '%s'
%s: orphaned mapped alias: user %s subj %s cert %s
@&!*@*@(alias.dir.renamefail)Failed to rename suspect Alias store directory '%s' to '%s'%s: failed to set up Alias store directory tree
%s: failed to init alias store; exiting
Error: xmlsec1 lib version mismatch
xmlSecCryptoAppInit() failed %d
%s: Using xmlsec1 %d.%d.%d for XML signature support
%s: failed to init verification; exiting
Failed to initialize the listen connection mapmaxDataConnectionsPerUser set to invalid value of %d, using default of %d instead
Maximum number of data connections per user set to %dFailed to initialize the data connection mapstrlen(conn->pipeName) < UNIX_PATH_MAX%s: failed to create public listen sock; exiting
%s: failed to listen on public sock; exiting
%s: failed to setup public listen channel
Couldn't parse line from catalog: %s%s: removed empty alias file '%s'
<?xml version="1.0" encoding="UTF-8" ?>
<alias>
   <pemCertificate>%s</pemCertificate>
   <aliasInfos>
      <aliasInfo>
         <subject>%s</subject>
         <comment>%s</comment>
      </aliasInfo>
      <aliasInfo>
         <anySubject/>
         <comment>%s</comment>
      </aliasInfo>
%s: Unable to look up userinfo to change ownership of '%s' to '%s'
%s: removed empty map file '%s'
  <mapping>
    <pemCertificate>%s</pemCertificate>
    <userName>%s</userName>
    <subjects>
@&!*@*@(alias.alias.badfile)Alias store '%s' exists but is not a regular file.  The Aliases for user '%s' will not be available for authentication%s: alias store file %s exists but isn't a regular file, punting
@&!*@*@(alias.mapping.badfile)Mapping file '%s' exists but is not a regular file.  The Aliases in the mapping file will not be available for authentication%s: map file %s exists but isn't a regular file, punting
SSL error: %lu (%s) in %s func %s line %d
%s: unable to convert string to BIO
%s: unable to convert string to x509
%s: out of memory creating BIO
Failed to validate doc against schema
Failed to validate token against schema
%s: Missing SubjectConfirmation method
urn:oasis:names:tc:SAML:2.0:cm:bearer%s: subjConfirmData time check failed
%s: audience check: token: '%s', host: '%s' ? %d
Missing x509 certificate node(s)
Missing x509 certificate base64 data
%s: Failed to add cert to key manager
Failed to add cert to key manager
%s: token is hostVerified, skipping signature checkFailed to limit allowed key data
%s: Signature is invalid (got %d)
%s: signature is invalid (got %d)
%s: failed to convert cert to X509
%s: unrelated cert subject: %s
%s: Success!  no unrelated certs found
Unrelated certs found in SAML token, failing
%s: failed to load mapped aliases
%s: no mapping entries or specified userName
%s: found more than one user in map file chain
%s: no matching cert and subject found in mapping file
%s: %d certs in store for user %s
%s: No trusted certs in chain
%s: failed to convert PEM cert to X509
%s: failed to convert untrusted chain
%s: failed to convert trusted chain
%s: unable to create x509 store
%s: unable to create x509 store context
%s: unable to init x509 store context
%s: unable to verify x509 certificate (ret = %d)
%s: cert chain validation failed
%s: cert chain successfully validatedmatchIdIdx >= 0 && matchSiIdx >= 0%s: ServiceVerifyAndCheckTrustCertChainForSubject() returned %Lu
@&!*@*@(validate.samlBearer.fail)Validation of SAML bearer token failed: %d@&!*@*@(validate.samlBearer.success)Validated SAML bearer token for user '%s'<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber><userName>%s</userName><token>%s</token><samlInfo><samlSubject>%s</samlSubject><aliasInfo><subject>%s</subject><comment>%s</comment></aliasInfo><aliasInfo><anySubject/><comment>%s</comment></aliasInfo>ServiceNetWorkWriteData() failed, pipe = %s%s: Unrecognized condition found!
%s: No Conditions found, accepting
Failed to verify Subject node
%s: NameID not found in Subject
%s: %d unrelated certs found in list
%s: read EOF on Connection %d
%s: g_markup_parse_context_parse() failed: %s
No Subject type specified (assuming removeAll case)
Unknown request type -- no request specific data
@&!*@*@(proto.attack)Possible security attack!  Request type %d has a userName (%s) which doesn't match the pipe owner (%s)!%s: Possible security attack!  Request type %d has a userName (%s) which doesn't match the pipe owner (%s)!
%s: Unrecognized request type '%d'
%s: security check failed for request type %d
%s: version mismatch.  Client is %d, want %d
sessionRequest failed; version mismatchg_hash_table_lookup(listenConnectionMap, userName) == NULL%s: removing dead userConn for %s from hashtable%s: removing failed userConn for %s<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber><version>1</version><pipeName>%s</pipeName></reply>%s: failed to send SessionReq reply
<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber><challengeEvent>%s</challengeEvent></reply>%s: failed to send Connect reply
%s: client tried to add a duplicate subject '%s' for user '%s'
%s: client tried to add a duplicate mapping entry for subject '%s' and cert '%s'
@&!*@*@(alias.addid)Alias added to Alias store owned by '%s' by user '%s'%s: alias added with Subject '%s'<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber></reply>%s: failed to send AddSubject reply
@&!*@*@(alias.removeid)Alias removed from Alias store owned by '%s' by user '%s'%s: all aliases removed for requested username%s: alias removed with Subject '%s'%s: failed to send RemoveAlias reply
<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber>%s: failed to send QueryAliases reply
<mappedAliases><userName>%s</userName><pemCert>%s</pemCert><subjects>%s: Failed to open random device: %d
TicketGenerateTicket() failed, user = %s<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber><ticket>%s</ticket></reply>%s: failed to send CreateTicket reply
<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber><userName>%s</userName><token>%s</token><userHandleInfo><userHandleType>%s</userHandleType><samlInfo><samlSubject>%s</samlSubject>%s: processed reqType %d(%s REQ), returning %Lu on connection %d
%s: failed to setup private listen channel
%s: Already have a connection for user '%s', but the user check failed, so tearing down the connection and trying to rebuild
-----BEGIN CERTI-----END CERTIFI%s: Failed to set up VMX logging
%s: failed to create X509 stack
%s: failed to add cert to stack
sk_X509_num(chain) == numCerts%s: Using '%s' as preferences filepath
%s: g_key_file_load_from_file(%s) failed: %s
%s: Couldn't open PID path [%s], error %u.
%s: Lock held on PID path [%s], error %u, not daemonizing.
%s: Couldn't create pipe, error %u.
%s: Couldn't set close-on-exec for fd %d, error %u.
%s: Couldn't fork first child, error %u.
%s: Child %d exited with error %d.
%s: Child %d exited with signal %d.
%s: Child could not exec %s, read %d, error %u.
%s: Couldn't create new session, error %d.
%s: Couldn't chdir to /, error %u.
%s: Couldn't write to parent pipe: %u, original error: %u.
%s: Couldn't truncate path [%s], error %d.
%s: Couldn't write PID to path [%s], error %d.
%s: Couldn't flush PID to path [%s], error %d.
%s: Couldn't exec %s, error %d.
%s: size of %s too large %d; failing read
%s: mapping file %s exists but isn't a regular file, punting
%s: file %s exists but isn't a regular file, punting
%s: failed to open %s for read (%d)
%s: size of %s changed (%d vs %d)
%s: mode of %s changed (%d vs %d)
%s: uid of %s changed (%d vs %d vs %d)
%s: gid of %s changed (%d vs %d vs %d)
%s: realpath() failed. errno (%d)
%s: Real path (%s) is not same as file path (%s)
%s: failed to read from file %s (%d)
%s: Pref_GetBool(%s) failed: %s
%s: Pref_GetInt(%s) failed: %s
%s: Pref_GetString(%s) failed: %s
Failed to set core dump size limit, error %d (%s)
%s: Unrecognized loglevel '%s'
VGAuthService%s '%s' logging at level '%s'
%s: %d preference groups in file '%s'
%s: g_key_file_get_keys(%s) failed: %s
%s: g_key_file_get_value(%s:%s) failed: %s
/etc/vmware-tools/vgauth.confservicePosix.cargspath%s: Couldn't fork, error %d.
/dev/nullpidPathFd >= 0%ld
MsgHasMsgID(msgid)len <= MSG_MAX_ID - 1@&!*@*@X%s: lstat(%s) failed (%d %d)
%s: fstat(%s) failed (%d %d)
../common/prefs.ckeyFile<default> resettingenableCoreDumpsCore dump limit set to %denableLogging/var/log/vmware-vgauthsvc.loglogfile%s: Using '%s' as logfile
data->path != NULLmaxOldLogFilesmaxLogSizeverbose%s: End of preferences
Group '%s'
	 %s=%s
normalloglevelPref_GetStringPref_GetIntPref_GetBoolServiceLoadFileContentsPosixAliasLoadMappedPref_LogAllEntriesServiceFileLogger_InitService_InitLoggingServiceDaemonizePref_InitPEMChainToStackVMXRPC_Init;�Ztt������4Ą��LԔ�����4���������d����x������d����4������������8�`$����4����4������������$����DD����ĸ�����������$�P4���ht����$����T�����Dd��|$������HT��dt���D������	���d	����	���
��l
$���
����
D��
�4T�h���4��T��d�<�p$���� 
D�d
��
����84�tD��d����(��xT����t������h�����������������D������$������$��(���d�����:���i����i���k���k��8t���v���D{���}����}����~��$���XzRx�����&D$4`q�� FJw�?:*3$"\X���0tp����8���
�4���3�`���(�\���_B�D�A �PAB������$L���\F�A�G CDB,0����
J�s
�KV
�J��A�$`d���CE�A�G qCA�����(E�M
FO4�����E�r
IG
IG
IG
IW
I,�t����E�r
IG
IG
IW
ID���pI�`,�����I��
OLh����I��
OHl8����F�N�P �A(�I0T
(D ABBEb(D ABB�����rE�Y
JH����GB�B�B �B(�A0�A8�G��
8D0A(B BBBE( ���zE�D�D@~
AAC(Lh���UE�D�D@}
DAAx����<Hs���<Hs(����E�H�J�L
AAKH�p���-F�D�B �B(�A0�A8�FPU
8A0A(B BBBK ԍ��P������(@4���2F�A�G�X
ABG4lH����F�A�A �|
GPM^
ABG\����F�A�A ��
ABG�
ABDD
GPMZ
ABC�
ABCh@����F�D�D �G
LPO[
ABB[
ABB[
ABB[
ABB[
ABBp���p��j�8����F�H�D �A(�G0i
(D ABBL8�����F�A�A �w
DBK�
DBH8`���F�A�A �w
DBKL
DBNH@����B�D�L �E(�A0�A8�G��
8D0A(B BBBA@�H�� B�B�A �A(�G� L�@L�P�
(A ABBA\�$���B�E�E �D(�D0�g
(F BBBIA
(C BBBF`(C BBB`0���aF�B�B �B(�G0�D8�G�p�J�J�M�K�M
8D0A(B BBBD<����I�K�I �B(�A0�
(E BBBD�p���E��$���lB�A�D ^DB@L���B�E�B �B(�A0�GP�
0D(B BBBA0\���DB�B�A �D0
 DBBJ�����Hx�\��Ed``����B�B�B �B(�A0�A8�G� L�@I�A|�AN�AU�AA�Ai
8A0A(B BBBG<$	P��B�D�I �A(�O��
(D ABBG0d	 ���B�B�D �G@v
 ABBF`�	���B�B�B �B(�A0�A8�G� L�@I�Au�AN�AU�AA�Ah
8A0A(B BBBGH�	H��{B�B�B �A(�D0�V
(A BBBHA(C BBB@H
|���B�D�D �s
ABHc
ABBgAB\�
����B�B�B �A(�A0�G� L�@I�@T�@G�@P�@F�@H�@Z
0A(A BBBA8�
H���B�E�D �D(�J��
(A ABBA4(����B�A�C �`
ABGh
ABA8`D���J�A�D o
D�A�M���H ������	L����B�B�A �A(�G� L�"��"W�"R�"A�"Z
(A ABBAL��B�B�A �A(�G� L�"��"W�"R�"A�"Z
(A ABBALPT�TF�N�P �A(�G��
(F ABBH��T�f�A�\�d�hB�E�B �B(�A0�A8�G��
8A0A(B BBBF��`�O�A�,
t� F�A�G�
	
ABA\0
d��F�P�E �E(�D0�D8�GPMXL`VhApIXJ`WhApI8A0A(B BBB�
���E�L�
|��B�B�B �D(�D0�G`t
0D(A BBBDIhNp{hA`�
��IEA],��B�A�A ��
ABA$D`�kE�D�D WAA�l���F�B�E �E(�D0�D8�J��
8A0A(B BBBE�K�V�F�I
�G�UD
�G�UD�\�R�F�D���bF�H�A �j
ABDf
ABGI(a0j(A  8��E�M��
AD�\�����F�B�B �B(�D0�A8�J�N�L�n�A�l�K�I�B�{�O�H�B���P�]�A��
8D0A(B BBBA	�J�T�B��V�d�B�?�^�H�A� �T�I�B��8��B�B�B �B(�A0�A8�I��
8D0A(B BBBDP	�^�H�A�I�P�g�A�Z�M�r�A�N�M�o�B�*�N�m�A�2�_�J�B�\�$��$F�B�B �B(�A0�A8�D���K�_�A�@
8A0A(B BBBA8P����F�B�A ��
BBI�
BEE0�H���B�E�A �D0�
 DBBF\����B�B�B �B(�A0�A8�G���g�H�A�z
8D0A(B BBBA� �%��P.F�B�E �B(�A0�A8�G��
8D0A(B BBBE�C�K�B���C�J�B��D�J�A�v�I�^�E� �hS���M�M
Fk
UH��S��lF�B�B �E(�D0�A8�D@V
8D0A(B BBBE0,�T���F�O�A �D0|
 AABF\`�U��,F�B�E �B(�A0�A8�G�t
8D0A(B BBBA>�X�R�A�D�t]���F�B�B �A(�D0�G�l
0D(A BBBC�_��:F�B�B �B(�A0�A8�G� L�#
8D0A(B BBBG��#^�#H�#A�#�#K�#\�#A�#[
�#G�#UI
�#W�#HD
�#K�#QA
�#K�#LH��c���F�D�E �B(�D0�A8�G��
8D0A(B BBBD(�0e���E�A�D0}
AAG( �e���E�A�D0}
AAG0L�f��F�A�A �D0Y
 DABD\�dg��{F�N�B �I(�D0�A8�F�X
8A0A(B BBBD��O�l�A�@���s��Ȃт݂���
�	�
&�@�Ў ����,=Uer~�P
�`�����o���
8X62P	���o���o1���o�o�.���o�0P@PPP`PpP�P�P�P�P�P�P�P�PQQ Q0Q@QPQ`QpQ�Q�Q�Q�Q�Q�Q�Q�QRR R0R@RPR`RpR�R�R�R�R�R�R�R�RSS S0S@SPS`SpS�S�S�S�S�S�S�S�STT T0T@TPT`TpT�T�T�T�T�T�T�T�TUU U0U@UPU`UpU�U�U�U�U�U�U�U�UVV V0V@VPV`VpV�V�V�V�V�V�V�V�VWW W0W@WPW`WpW�W�W�W�W�W�W�W�WXX X0X@XPX`XpX�X�X�X�X�X�X�X�XYY Y0Y@YPY`YpY�Y�Y�Y�Y�Y�Y�Y�YZZ Z0Z@ZPZ`ZpZ�Z�Z�Z�Z�Z�Z�Z�Z[[ [0[@[P[`[p[�[�[�[�[�[�[�[�[\\ \0\@\P\`\p\�\�\�\�\�\�\�\�\]] ]0]@]P]`]p]�]�]�]�]�]�]�]�]^^ ^0^@^P^`^p^�^�^�^�^�^�^�^�^__ _0_@_P_`_p_�_�_�_�_�_�_�_�_`` `0` �����Q,|P� �`������0�/usr/lib/debug/.dwz/x86_64-linux-gnu/open-vm-tools.debug��|S>�nT��v���c2W]�76db7c1f690a15bd2b039fef6e8e1b708616ce.debug��|l.shstrtab.interp.note.gnu.property.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.data.bss.gnu_debugaltlink.gnu_debuglink880&hh$9�� G���o��0Q���Y��a���o�.�.*n���o11�}22P�BX6X6�PP� P P �@`@`0�p`p`��p�pk���`�`
�pp�k ��������������������� ���P�88� � 	� � �M 44/

Filemanager

Name Type Size Permission Actions
X11 Folder 0755
NF File 963 B 0755
VGAuthService File 134.54 KB 0755
[ File 50.44 KB 0755
aa-enabled File 34.52 KB 0755
aa-exec File 34.52 KB 0755
aa-features-abi File 30.52 KB 0755
ab File 58.43 KB 0755
add-apt-repository File 14.14 KB 0755
addpart File 14.38 KB 0755
addr2line File 26.7 KB 0755
apport-bug File 2.51 KB 0755
apport-cli File 13.05 KB 0755
apport-collect File 2.51 KB 0755
apport-unpack File 2.02 KB 0755
appres File 14.3 KB 0755
apropos File 47.28 KB 0755
apt File 18.38 KB 0755
apt-add-repository File 14.14 KB 0755
apt-cache File 82.47 KB 0755
apt-cdrom File 26.47 KB 0755
apt-config File 26.39 KB 0755
apt-extracttemplates File 22.47 KB 0755
apt-ftparchive File 230.48 KB 0755
apt-get File 50.47 KB 0755
apt-key File 27.51 KB 0755
apt-mark File 50.47 KB 0755
apt-sortpkgs File 38.4 KB 0755
ar File 54.48 KB 0755
arch File 30.51 KB 0755
aria_chk File 4.51 MB 0755
aria_dump_log File 4.3 MB 0755
aria_ftdump File 4.31 MB 0755
aria_pack File 4.34 MB 0755
aria_read_log File 4.46 MB 0755
as File 456.4 KB 0755
automat-visualize3 File 405 B 0755
awk File 688.46 KB 0755
b2sum File 50.52 KB 0755
base32 File 34.51 KB 0755
base64 File 34.51 KB 0755
basename File 34.51 KB 0755
basenc File 46.51 KB 0755
bash File 1.33 MB 0755
bashbug File 6.66 KB 0755
bc File 90.82 KB 0755
boltctl File 122.98 KB 0755
bootctl File 70.49 KB 0755
btrfs File 844.13 KB 0755
btrfs-convert File 483.25 KB 0755
btrfs-find-root File 439.33 KB 0755
btrfs-image File 467.25 KB 0755
btrfs-map-logical File 439.25 KB 0755
btrfs-select-super File 439.25 KB 0755
btrfsck File 844.13 KB 0755
btrfstune File 443.26 KB 0755
bunzip2 File 38.38 KB 0755
busctl File 90.49 KB 0755
busybox File 2.09 MB 0755
byobu File 8.17 KB 0755
byobu-config File 996 B 0755
byobu-ctrl-a File 4.66 KB 0755
byobu-disable File 1.26 KB 0755
byobu-disable-prompt File 1.31 KB 0755
byobu-enable File 1.15 KB 0755
byobu-enable-prompt File 1.42 KB 0755
byobu-export File 1.32 KB 0755
byobu-janitor File 6.29 KB 0755
byobu-keybindings File 1.47 KB 0755
byobu-launch File 3.25 KB 0755
byobu-launcher File 1.87 KB 0755
byobu-launcher-install File 2.4 KB 0755
byobu-launcher-uninstall File 1.52 KB 0755
byobu-layout File 3.27 KB 0755
byobu-prompt File 1.13 KB 0755
byobu-quiet File 1.38 KB 0755
byobu-reconnect-sockets File 3.22 KB 0755
byobu-screen File 8.17 KB 0755
byobu-select-backend File 1.42 KB 0755
byobu-select-profile File 5 KB 0755
byobu-select-session File 1012 B 0755
byobu-shell File 1.56 KB 0755
byobu-silent File 1.28 KB 0755
byobu-status File 5.87 KB 0755
byobu-status-detail File 1.18 KB 0755
byobu-tmux File 8.17 KB 0755
byobu-ugraph File 4.56 KB 0755
byobu-ulevel File 11.71 KB 0755
bzcat File 38.38 KB 0755
bzcmp File 2.17 KB 0755
bzdiff File 2.17 KB 0755
bzegrep File 3.69 KB 0755
bzexe File 4.78 KB 0755
bzfgrep File 3.69 KB 0755
bzgrep File 3.69 KB 0755
bzip2 File 38.38 KB 0755
bzip2recover File 14.3 KB 0755
bzless File 1.27 KB 0755
bzmore File 1.27 KB 0755
c++filt File 22.27 KB 0755
c_rehash File 6.8 KB 0755
captoinfo File 86.41 KB 0755
cat File 34.46 KB 0755
catman File 34.76 KB 0755
cautious-launcher File 853 B 0755
certbot File 961 B 0755
cftp3 File 956 B 0755
cgi-fcgi File 18.15 KB 0755
chage File 70.49 KB 2755
chardet File 965 B 0755
chardetect File 965 B 0755
chattr File 14.31 KB 0755
chcon File 58.51 KB 0755
checkgid File 14.3 KB 0755
chfn File 71.01 KB 4755
chgrp File 54.51 KB 0755
chmod File 54.51 KB 0755
choom File 22.38 KB 0755
chown File 58.51 KB 0755
chrt File 26.38 KB 0755
chsh File 43.76 KB 4755
chvt File 14.23 KB 0755
cifsiostat File 22.45 KB 0755
ckbcomp File 146.31 KB 0755
ckeygen3 File 962 B 0755
cksum File 34.41 KB 0755
clear File 14.31 KB 0755
clear_console File 14.23 KB 0755
cloud-id File 966 B 0755
cloud-init File 970 B 0755
cloud-init-per File 2.06 KB 0755
clusterdb File 9.21 KB 0755
cmp File 42.39 KB 0755
codepage File 14.15 KB 0755
col File 22.38 KB 0755
col1 File 963 B 0755
col2 File 963 B 0755
col3 File 963 B 0755
col4 File 963 B 0755
col5 File 963 B 0755
col6 File 963 B 0755
col7 File 963 B 0755
col8 File 963 B 0755
col9 File 963 B 0755
colcrt File 14.38 KB 0755
colrm File 14.38 KB 0755
column File 34.38 KB 0755
comm File 34.52 KB 0755
compose File 18.06 KB 0755
composer File 2.62 KB 0755
conch3 File 958 B 0755
containerd File 49.85 MB 0755
containerd-shim File 7.01 MB 0755
containerd-shim-runc-v1 File 9.03 MB 0755
containerd-shim-runc-v2 File 9.05 MB 0755
corelist File 15.01 KB 0755
corepack File 174 B 0755
cp File 138.51 KB 0755
cpan File 8.16 KB 0755
cpan5.34-x86_64-linux-gnu File 8.18 KB 0755
cpio File 141.64 KB 0755
createdb File 9.21 KB 0755
createlang File 9.21 KB 0755
createuser File 9.21 KB 0755
crontab File 38.64 KB 2755
csplit File 106.51 KB 0755
ctail File 960 B 0755
ctr File 25.88 MB 0755
ctstat File 22.66 KB 0755
curl File 254.23 KB 0755
cut File 38.51 KB 0755
cvtsudoers File 296.4 KB 0755
dash File 122.74 KB 0755
date File 102.51 KB 0755
dbilogstrip File 1.35 KB 0755
dbiprof File 6.06 KB 0755
dbiproxy File 5.27 KB 0755
dbus-cleanup-sockets File 14.29 KB 0755
dbus-daemon File 227.32 KB 0755
dbus-monitor File 26.29 KB 0755
dbus-run-session File 14.29 KB 0755
dbus-send File 26.29 KB 0755
dbus-update-activation-environment File 14.29 KB 0755
dbus-uuidgen File 14.29 KB 0755
dbxtool File 26.3 KB 0755
dd File 66.52 KB 0755
deallocvt File 14.23 KB 0755
deb-systemd-helper File 20.89 KB 0755
deb-systemd-invoke File 6.01 KB 0755
debconf File 2.79 KB 0755
debconf-apt-progress File 11.27 KB 0755
debconf-communicate File 608 B 0755
debconf-copydb File 1.68 KB 0755
debconf-escape File 647 B 0755
debconf-set-selections File 2.92 KB 0755
debconf-show File 1.78 KB 0755
debian-distro-info File 22.95 KB 0755
delpart File 14.38 KB 0755
delv File 45.32 KB 0755
df File 83.08 KB 0755
dfu-tool File 110.3 KB 0755
dh_bash-completion File 4.31 KB 0755
dh_perl_dbi File 1.17 KB 0755
diff File 130.55 KB 0755
diff3 File 54.52 KB 0755
dig File 150.83 KB 0755
dir File 134.98 KB 0755
dircolors File 38.52 KB 0755
dirmngr File 433.02 KB 0755
dirmngr-client File 54.92 KB 0755
dirname File 30.38 KB 0755
distro-info File 22.89 KB 0755
dmesg File 70.61 KB 0755
dnsdomainname File 22.23 KB 0755
do-release-upgrade File 10.42 KB 0755
docker File 34.25 MB 0755
docker-proxy File 2.07 MB 0755
dockerd File 95.23 MB 0755
dockerd-rootless-setuptool.sh File 13.62 KB 0755
dockerd-rootless.sh File 5.07 KB 0755
domainname File 22.23 KB 0755
dpkg File 310.69 KB 0755
dpkg-deb File 134.49 KB 0755
dpkg-divert File 118.49 KB 0755
dpkg-maintscript-helper File 20.71 KB 0755
dpkg-query File 138.52 KB 0755
dpkg-realpath File 4.09 KB 0755
dpkg-split File 98.51 KB 0755
dpkg-statoverride File 46.26 KB 0755
dpkg-trigger File 42.41 KB 0755
dropdb File 9.21 KB 0755
droplang File 9.21 KB 0755
dropuser File 9.21 KB 0755
du File 146.51 KB 0755
dumpkeys File 158.71 KB 0755
dwp File 1.82 MB 0755
eatmydata File 2.74 KB 0755
ec2metadata File 8.38 KB 0755
echo File 34.3 KB 0755
ed File 54.49 KB 0755
edit File 18.06 KB 0755
editor File 276.52 KB 0755
editres File 72.69 KB 0755
egrep File 28 B 0755
eject File 42.23 KB 0755
elfedit File 34.72 KB 0755
enc2xs File 40.84 KB 0755
encguess File 3.01 KB 0755
env File 42.95 KB 0755
envsubst File 34.38 KB 0755
eqn File 188.45 KB 0755
ex File 3.61 MB 0755
expand File 34.53 KB 0755
expiry File 22.59 KB 2755
expr File 102.41 KB 0755
factor File 70.51 KB 0755
faillog File 22.59 KB 0755
fallocate File 22.38 KB 0755
false File 26.3 KB 0755
fc-cache File 22.23 KB 0755
fc-cat File 18.23 KB 0755
fc-conflist File 14.23 KB 0755
fc-list File 14.23 KB 0755
fc-match File 14.23 KB 0755
fc-pattern File 14.23 KB 0755
fc-query File 14.23 KB 0755
fc-scan File 14.23 KB 0755
fc-validate File 14.23 KB 0755
fcgistarter File 14.3 KB 0755
fgconsole File 14.23 KB 0755
fgrep File 28 B 0755
filan File 46.48 KB 0755
file File 26.56 KB 0755
finalrd File 2.06 KB 0755
fincore File 22.42 KB 0755
find File 275.48 KB 0755
findmnt File 63.61 KB 0755
flock File 22.48 KB 0755
fmt File 38.51 KB 0755
fold File 34.51 KB 0755
free File 26.23 KB 0755
ftp File 178.9 KB 0755
funzip File 22.3 KB 0755
fuser File 39.31 KB 0755
fusermount File 34.38 KB 4755
fusermount3 File 34.38 KB 4755
fwupdagent File 190.3 KB 0755
fwupdate File 82.3 KB 0755
fwupdmgr File 190.3 KB 0755
fwupdtool File 394.92 KB 0755
galera_new_cluster File 917 B 0755
galera_recovery File 3.29 KB 0755
gapplication File 22.38 KB 0755
gawk File 688.46 KB 0755
gdbus File 50.38 KB 0755
gdk-pixbuf-csource File 14.33 KB 0755
gdk-pixbuf-pixdata File 14.31 KB 0755
gdk-pixbuf-thumbnailer File 18.39 KB 0755
geqn File 188.45 KB 0755
getconf File 34.29 KB 0755
getent File 38.65 KB 0755
getkeycodes File 14.23 KB 0755
getopt File 22.38 KB 0755
gettext File 34.38 KB 0755
gettext.sh File 5.07 KB 0755
ginstall-info File 103.23 KB 0755
gio File 90.4 KB 0755
gio-querymodules File 14.3 KB 0755
git File 3.54 MB 0755
git-receive-pack File 3.54 MB 0755
git-shell File 552.58 KB 0755
git-upload-archive File 3.54 MB 0755
git-upload-pack File 3.54 MB 0755
glib-compile-schemas File 50.3 KB 0755
gold File 3.04 MB 0755
gpasswd File 70.38 KB 4755
gpg File 1 MB 0755
gpg-agent File 312.96 KB 0755
gpg-connect-agent File 82.99 KB 0755
gpg-wks-server File 115.05 KB 0755
gpg-zip File 3.43 KB 0755
gpgcompose File 496.48 KB 0755
gpgconf File 126.73 KB 0755
gpgparsemail File 34.38 KB 0755
gpgsm File 418.9 KB 0755
gpgsplit File 26.55 KB 0755
gpgtar File 63.39 KB 0755
gpgv File 271.04 KB 0755
gpic File 200.04 KB 0755
gprof File 111.79 KB 0755
gpu-manager File 78.82 KB 0755
grep File 178.45 KB 0755
gresource File 22.3 KB 0755
groff File 94.5 KB 0755
grog File 2.71 KB 0755
grops File 162.55 KB 0755
grotty File 118.52 KB 0755
groups File 34.51 KB 0755
growpart File 26.22 KB 0755
grub-editenv File 376.95 KB 0755
grub-file File 816.45 KB 0755
grub-fstest File 937.92 KB 0755
grub-glue-efi File 247.86 KB 0755
grub-kbdcomp File 1.64 KB 0755
grub-menulst2cfg File 228.13 KB 0755
grub-mkfont File 272.42 KB 0755
grub-mkimage File 361.05 KB 0755
grub-mklayout File 252.17 KB 0755
grub-mknetdir File 417.66 KB 0755
grub-mkpasswd-pbkdf2 File 256.2 KB 0755
grub-mkrelpath File 247.58 KB 0755
grub-mkrescue File 998.47 KB 0755
grub-mkstandalone File 493.95 KB 0755
grub-mount File 760.84 KB 0755
grub-ntldr-img File 38.24 KB 0755
grub-render-label File 828.83 KB 0755
grub-script-check File 275.7 KB 0755
grub-syslinux2cfg File 781.34 KB 0755
gsettings File 30.3 KB 0755
gtbl File 126.48 KB 0755
gtk-update-icon-cache File 38.57 KB 0755
gunzip File 2.29 KB 0755
gzexe File 6.3 KB 0755
gzip File 91.23 KB 0755
h2ph File 28.54 KB 0755
h2xs File 59.51 KB 0755
hardlink File 34.43 KB 0755
hd File 50.39 KB 0755
head File 42.51 KB 0755
helpztags File 2.46 KB 0755
hexdump File 50.39 KB 0755
host File 118.82 KB 0755
hostid File 30.51 KB 0755
hostname File 22.23 KB 0755
hostnamectl File 30.38 KB 0755
htcacheclean File 38.31 KB 0755
htdbm File 26.3 KB 0755
htdigest File 14.3 KB 0755
htop File 277.19 KB 0755
htpasswd File 26.3 KB 0755
hwe-support-status File 10.58 KB 0755
i386 File 26.65 KB 0755
iconv File 66.41 KB 0755
id File 38.51 KB 0755
info File 301.74 KB 0755
infobrowser File 301.74 KB 0755
infocmp File 62.38 KB 0755
infotocap File 86.41 KB 0755
innochecksum File 3.57 MB 0755
innotop File 445.44 KB 0755
install File 142.52 KB 0755
install-info File 103.23 KB 0755
instmodsh File 4.27 KB 0755
ionice File 18.38 KB 0755
iostat File 54.44 KB 0755
ip File 702.05 KB 0755
ipcmk File 22.45 KB 0755
ipcrm File 18.38 KB 0755
ipcs File 38.38 KB 0755
iptables-xml File 96.95 KB 0755
ischroot File 14.2 KB 0755
iscsiadm File 398.46 KB 0755
java File 14.13 KB 0755
jexec File 14.12 KB 0755
join File 46.55 KB 0755
journalctl File 78.39 KB 0755
jpackage File 14.14 KB 0755
js File 117.69 MB 0755
json-patch-jsondiff File 1004 B 0755
json_pp File 4.88 KB 0755
json_xs File 6.85 KB 0755
jsondiff File 1004 B 0755
jsonlint-php File 3.01 KB 0755
jsonpatch File 3.77 KB 0755
jsonpointer File 1.79 KB 0755
jsonschema File 397 B 0755
kbd_mode File 14.52 KB 0755
kbdinfo File 18.23 KB 0755
kbxutil File 62.83 KB 0755
keep-one-running File 3.51 KB 0755
kernel-install File 4.79 KB 0755
keyring File 961 B 0755
keytool File 14.14 KB 0755
kill File 30.23 KB 0755
killall File 31.34 KB 0755
kmod File 166.36 KB 0755
kmodsign File 18.45 KB 0755
landscape-sysinfo File 624 B 0755
last File 34.38 KB 0755
lastb File 34.38 KB 0755
lastlog File 27.63 KB 0755
lcf File 7.6 KB 0755
ld File 1.66 MB 0755
ld.bfd File 1.66 MB 0755
ld.gold File 3.04 MB 0755
ldd File 5.32 KB 0755
less File 194.38 KB 0755
lessecho File 14.31 KB 0755
lessfile File 8.83 KB 0755
lesskey File 23.7 KB 0755
lesspipe File 8.83 KB 0755
letsencrypt File 961 B 0755
lexgrog File 99.75 KB 0755
libnetcfg File 15.41 KB 0755
link File 30.51 KB 0755
linux-boot-prober File 1.54 KB 0755
linux-check-removal File 3.99 KB 0755
linux-update-symlinks File 6.17 KB 0755
linux-version File 2.63 KB 0755
linux32 File 26.65 KB 0755
linux64 File 26.65 KB 0755
listres File 14.73 KB 0755
ln File 58.51 KB 0755
lnstat File 22.66 KB 0755
loadkeys File 198.76 KB 0755
loadunimap File 30.32 KB 0755
locale File 57.56 KB 0755
locale-check File 14.15 KB 0755
localectl File 26.37 KB 0755
localedef File 326.96 KB 0755
logger File 34.97 KB 0755
login File 51.73 KB 0755
loginctl File 58.48 KB 0755
logname File 30.51 KB 0755
logresolve File 14.31 KB 0755
look File 18.38 KB 0755
lowntfs-3g File 114.98 KB 0755
ls File 134.98 KB 0755
lsattr File 14.31 KB 0755
lsb_release File 3.55 KB 0755
lsblk File 122.38 KB 0755
lscpu File 98.38 KB 0755
lshw File 901.2 KB 0755
lsinitramfs File 706 B 0755
lsipc File 50.38 KB 0755
lslocks File 30.7 KB 0755
lslogins File 50.38 KB 0755
lsmem File 34.38 KB 0755
lsmod File 166.36 KB 0755
lsns File 38.38 KB 0755
lsof File 163.62 KB 0755
lspci File 92.08 KB 0755
lspgpot File 1.06 KB 0755
lsusb File 246.52 KB 0755
luit File 48.44 KB 0755
lzcat File 82.52 KB 0755
lzcmp File 6.86 KB 0755
lzdiff File 6.86 KB 0755
lzegrep File 5.87 KB 0755
lzfgrep File 5.87 KB 0755
lzgrep File 5.87 KB 0755
lzless File 1.76 KB 0755
lzma File 82.52 KB 0755
lzmainfo File 14.23 KB 0755
lzmore File 2.11 KB 0755
mailmail3 File 964 B 0755
man File 117.68 KB 0755
man-recode File 35.68 KB 0755
mandb File 139.94 KB 0755
manifest File 1.9 KB 0755
manpath File 30.78 KB 0755
mapscrn File 30.32 KB 0755
mariadb File 4.09 MB 0755
mariadb-access File 109.31 KB 0755
mariadb-admin File 3.86 MB 0755
mariadb-analyze File 3.86 MB 0755
mariadb-binlog File 4.11 MB 0755
mariadb-check File 3.86 MB 0755
mariadb-conv File 3.57 MB 0755
mariadb-convert-table-format File 4.12 KB 0755
mariadb-dump File 3.94 MB 0755
mariadb-dumpslow File 8.05 KB 0755
mariadb-find-rows File 3.21 KB 0755
mariadb-fix-extensions File 1.22 KB 0755
mariadb-hotcopy File 34.15 KB 0755
mariadb-import File 3.85 MB 0755
mariadb-install-db File 22.46 KB 0755
mariadb-optimize File 3.86 MB 0755
mariadb-plugin File 3.55 MB 0755
mariadb-repair File 3.86 MB 0755
mariadb-report File 48.07 KB 0755
mariadb-secure-installation File 13.49 KB 0755
mariadb-service-convert File 2.45 KB 0755
mariadb-setpermission File 17.56 KB 0755
mariadb-show File 3.84 MB 0755
mariadb-slap File 3.86 MB 0755
mariadb-tzinfo-to-sql File 3.55 MB 0755
mariadb-upgrade File 3.98 MB 0755
mariadb-waitpid File 3.53 MB 0755
mariadbcheck File 3.86 MB 0755
mariadbd-multi File 26.7 KB 0755
mariadbd-safe File 30.42 KB 0755
mariadbd-safe-helper File 3.51 MB 0755
mawk File 154.79 KB 0755
mc File 1.05 MB 0755
mcdiff File 1.05 MB 0755
mcedit File 1.05 MB 0755
mcookie File 26.45 KB 0755
mcview File 1.05 MB 0755
md5sum File 42.41 KB 0755
md5sum.textutils File 42.41 KB 0755
mdig File 50.4 KB 0755
mesg File 14.38 KB 0755
migrate-pubring-from-classic-gpg File 2.99 KB 0755
mk_modmap File 15.78 KB 0755
mkdir File 66.51 KB 0755
mkfifo File 38.51 KB 0755
mknod File 42.51 KB 0755
mksquashfs File 254.68 KB 0755
mktemp File 38.51 KB 0755
more File 42.38 KB 0755
mount File 46.38 KB 4755
mountpoint File 18.38 KB 0755
mpstat File 50.45 KB 0755
msql2mysql File 1.41 KB 0755
mt File 66.73 KB 0755
mt-gnu File 66.73 KB 0755
mtr File 72.25 KB 0755
mtr-packet File 38.3 KB 0755
mv File 134.52 KB 0755
my_print_defaults File 3.54 MB 0755
myisam_ftdump File 3.86 MB 0755
myisamchk File 3.98 MB 0755
myisamlog File 3.85 MB 0755
myisampack File 3.88 MB 0755
mysql File 4.09 MB 0755
mysql_convert_table_format File 4.12 KB 0755
mysql_find_rows File 3.21 KB 0755
mysql_fix_extensions File 1.22 KB 0755
mysql_install_db File 22.46 KB 0755
mysql_plugin File 3.55 MB 0755
mysql_secure_installation File 13.49 KB 0755
mysql_setpermission File 17.56 KB 0755
mysql_tzinfo_to_sql File 3.55 MB 0755
mysql_upgrade File 3.98 MB 0755
mysql_waitpid File 3.53 MB 0755
mysqlaccess File 109.31 KB 0755
mysqladmin File 3.86 MB 0755
mysqlanalyze File 3.86 MB 0755
mysqlbinlog File 4.11 MB 0755
mysqlcheck File 3.86 MB 0755
mysqld_multi File 26.7 KB 0755
mysqld_safe File 30.42 KB 0755
mysqld_safe_helper File 3.51 MB 0755
mysqldump File 3.94 MB 0755
mysqldumpslow File 8.05 KB 0755
mysqlhotcopy File 34.15 KB 0755
mysqlimport File 3.85 MB 0755
mysqloptimize File 3.86 MB 0755
mysqlrepair File 3.86 MB 0755
mysqlreport File 48.07 KB 0755
mysqlshow File 3.84 MB 0755
mysqlslap File 3.86 MB 0755
mytop File 71.95 KB 0755
namei File 22.38 KB 0755
nano File 276.52 KB 0755
nawk File 688.46 KB 0755
nc File 38.63 KB 0755
nc.openbsd File 38.63 KB 0755
neqn File 913 B 0755
netcat File 38.63 KB 0755
networkctl File 102.38 KB 0755
networkd-dispatcher File 19.71 KB 0755
newgrp File 39.55 KB 4755
ngettext File 34.38 KB 0755
nice File 34.51 KB 0755
nisdomainname File 22.23 KB 0755
nl File 98.57 KB 0755
nm File 43.63 KB 0755
node File 117.69 MB 0755
nodejs File 117.69 MB 0755
nohup File 34.41 KB 0755
npm File 54 B 0755
nproc File 34.51 KB 0755
npx File 2.85 KB 0755
nroff File 3.22 KB 0755
nsenter File 26.6 KB 0755
nslookup File 118.82 KB 0755
nstat File 30.38 KB 0755
nsupdate File 74.55 KB 0755
ntfs-3g File 159.01 KB 0755
ntfs-3g.probe File 14.38 KB 0755
ntfscat File 26.38 KB 0755
ntfscluster File 38.38 KB 0755
ntfscmp File 30.38 KB 0755
ntfsdecrypt File 42.38 KB 0755
ntfsfallocate File 26.38 KB 0755
ntfsfix File 34.38 KB 0755
ntfsinfo File 54.38 KB 0755
ntfsls File 27.45 KB 0755
ntfsmove File 30.38 KB 0755
ntfsrecover File 106.38 KB 0755
ntfssecaudit File 78.86 KB 0755
ntfstruncate File 26.3 KB 0755
ntfsusermap File 18.3 KB 0755
ntfswipe File 42.91 KB 0755
numfmt File 54.54 KB 0755
nvidia-detector File 270 B 0755
objcopy File 162.54 KB 0755
objdump File 365.13 KB 0755
od File 66.51 KB 0755
oem-getlogs File 8.59 KB 0755
on_ac_power File 3.7 KB 0755
open File 18.06 KB 0755
openssl File 977.8 KB 0755
openvt File 22.59 KB 0755
os-prober File 4.44 KB 0755
pager File 194.38 KB 0755
partx File 58.38 KB 0755
passwd File 58.57 KB 4755
paste File 34.41 KB 0755
pastebinit File 16.12 KB 0755
patch File 186.52 KB 0755
pathchk File 34.51 KB 0755
pbget File 2.51 KB 0755
pbput File 2.51 KB 0755
pbputs File 2.51 KB 0755
pdb3 File 61.74 KB 0755
pdb3.10 File 61.74 KB 0755
peekfd File 14.3 KB 0755
perl File 3.63 MB 0755
perl5.34-x86_64-linux-gnu File 14.3 KB 0755
perl5.34.0 File 3.63 MB 0755
perlbug File 44.12 KB 0755
perldoc File 125 B 0755
perlivp File 10.61 KB 0755
perlthanks File 44.12 KB 0755
perror File 3.73 MB 0755
pg_archivecleanup File 9.21 KB 0755
pg_backupcluster File 17.02 KB 0755
pg_basebackup File 9.21 KB 0755
pg_buildext File 14.71 KB 0755
pg_config File 1.2 KB 0755
pg_conftool File 6.12 KB 0755
pg_createcluster File 34.53 KB 0755
pg_ctlcluster File 22.76 KB 0755
pg_dropcluster File 8.14 KB 0755
pg_dump File 9.21 KB 0755
pg_dumpall File 9.21 KB 0755
pg_isready File 9.21 KB 0755
pg_lsclusters File 5.21 KB 0755
pg_receivewal File 9.21 KB 0755
pg_receivexlog File 9.21 KB 0755
pg_recvlogical File 9.21 KB 0755
pg_renamecluster File 5.78 KB 0755
pg_restore File 9.21 KB 0755
pg_restorecluster File 13.46 KB 0755
pg_upgradecluster File 33.58 KB 0755
pg_virtualenv File 9.05 KB 0755
pgbench File 9.21 KB 0755
pgrep File 30.24 KB 0755
phar File 14.88 KB 0755
phar.phar File 14.88 KB 0755
phar.phar8.3 File 14.88 KB 0755
phar.phar8.4 File 14.88 KB 0755
phar8.3 File 14.88 KB 0755
phar8.3.phar File 14.88 KB 0755
phar8.4 File 14.88 KB 0755
phar8.4.phar File 14.88 KB 0755
php File 5.75 MB 0755
php8.3 File 5.53 MB 0755
php8.4 File 5.75 MB 0755
pic File 200.04 KB 0755
pico File 276.52 KB 0755
piconv File 8.16 KB 0755
pidof File 30.38 KB 0755
pidstat File 50.45 KB 0755
pidwait File 30.24 KB 0755
pigz File 134.36 KB 0755
pinentry File 58.65 KB 0755
pinentry-curses File 58.65 KB 0755
ping File 74.88 KB 0755
ping4 File 74.88 KB 0755
ping6 File 74.88 KB 0755
pinky File 34.41 KB 0755
pkaction File 18.3 KB 0755
pkcheck File 22.3 KB 0755
pkcon File 58.3 KB 0755
pkexec File 30.15 KB 4755
pkill File 30.24 KB 0755
pkmon File 22.3 KB 0755
pkttyagent File 18.3 KB 0755
pl2pm File 4.43 KB 0755
pldd File 22.37 KB 0755
plymouth File 46.3 KB 0755
pmap File 34.24 KB 0755
pod2html File 4.04 KB 0755
pod2man File 14.68 KB 0755
pod2text File 10.55 KB 0755
pod2usage File 4.01 KB 0755
podchecker File 3.57 KB 0755
pollinate File 8.54 KB 0755
pr File 66.58 KB 0755
preconv File 54.48 KB 0755
print File 18.06 KB 0755
printenv File 30.38 KB 0755
printf File 50.44 KB 0755
prlimit File 26.89 KB 0755
pro File 1003 B 0755
procan File 30.4 KB 0755
prove File 13.34 KB 0755
prtstat File 22.38 KB 0755
ps File 138.45 KB 0755
psfaddtable File 26.23 KB 0755
psfgettable File 26.23 KB 0755
psfstriptable File 26.23 KB 0755
psfxtable File 26.23 KB 0755
pslog File 14.3 KB 0755
psql File 9.21 KB 0755
pstree File 35.32 KB 0755
pstree.x11 File 35.32 KB 0755
ptar File 3.48 KB 0755
ptardiff File 2.58 KB 0755
ptargrep File 4.29 KB 0755
ptx File 126.55 KB 0755
purge-old-kernels File 1.12 KB 0755
pwd File 34.51 KB 0755
pwdx File 14.23 KB 0755
py3clean File 7.63 KB 0755
py3compile File 12.88 KB 0755
py3versions File 11.63 KB 0755
pybabel File 953 B 0755
pybabel-python3 File 953 B 0755
pydoc3 File 79 B 0755
pydoc3.10 File 79 B 0755
pygettext3 File 23.67 KB 0755
pygettext3.10 File 23.67 KB 0755
pyhtmlizer3 File 968 B 0755
pyserial-miniterm File 975 B 0755
pyserial-ports File 969 B 0755
python File 5.66 MB 0755
python3 File 5.66 MB 0755
python3.10 File 5.66 MB 0755
pzstd File 702.47 KB 0755
quirks-handler File 2.4 KB 0755
ranlib File 54.48 KB 0755
rbash File 1.33 MB 0755
rcp File 130.59 KB 0755
rdma File 98.52 KB 0755
readelf File 758.44 KB 0755
readlink File 38.41 KB 0755
realpath File 38.41 KB 0755
red File 89 B 0755
redis-benchmark File 730.66 KB 0755
redis-check-aof File 1.41 MB 0755
redis-check-rdb File 1.41 MB 0755
redis-cli File 354.13 KB 0755
redis-server File 1.41 MB 0755
reindexdb File 9.21 KB 0755
renice File 14.38 KB 0755
replace File 3.51 MB 0755
rescan-scsi-bus.sh File 38.05 KB 0755
reset File 26.31 KB 0755
resizecons File 26.32 KB 0755
resizepart File 22.38 KB 0755
resolve_stack_dump File 3.54 MB 0755
resolvectl File 130.52 KB 0755
resolveip File 3.54 MB 0755
rev File 14.38 KB 0755
rgrep File 30 B 0755
rlogin File 827.04 KB 0755
rm File 58.51 KB 0755
rmdir File 42.41 KB 0755
rmiregistry File 14.15 KB 0755
rnano File 276.52 KB 0755
rootlesskit File 11.64 MB 0755
rootlesskit-docker-proxy File 7.48 MB 0755
rotatelogs File 26.38 KB 0755
routef File 208 B 0755
routel File 1.62 KB 0755
rrsync File 12.34 KB 0755
rsh File 827.04 KB 0755
rsync File 506.13 KB 0755
rsync-ssl File 5.02 KB 0755
rtstat File 22.66 KB 0755
run-mailcap File 18.06 KB 0755
run-one File 3.51 KB 0755
run-one-constantly File 3.51 KB 0755
run-one-until-failure File 3.51 KB 0755
run-one-until-success File 3.51 KB 0755
run-parts File 26.54 KB 0755
run-this-one File 3.51 KB 0755
runc File 9.33 MB 0755
runcon File 34.51 KB 0755
rview File 3.61 MB 0755
rvim File 3.61 MB 0755
sadf File 390.24 KB 0755
sar File 133.45 KB 0755
sar.sysstat File 133.45 KB 0755
savelog File 10.24 KB 0755
sbattach File 26.54 KB 0755
sbkeysync File 34.74 KB 0755
sbsiglist File 14.6 KB 0755
sbsign File 34.7 KB 0755
sbvarsign File 22.73 KB 0755
sbverify File 34.61 KB 0755
scp File 130.59 KB 0755
screen File 466.24 KB 0755
screendump File 14.15 KB 0755
script File 50.38 KB 0755
scriptlive File 42.38 KB 0755
scriptreplay File 34.38 KB 0755
scsi_logging_level File 8.38 KB 0755
scsi_mandat File 3.52 KB 0755
scsi_readcap File 1.3 KB 0755
scsi_ready File 1.09 KB 0755
scsi_satl File 3.74 KB 0755
scsi_start File 1.25 KB 0755
scsi_stop File 1.44 KB 0755
scsi_temperature File 936 B 0755
sdiff File 46.39 KB 0755
sed File 110.57 KB 0755
see File 18.06 KB 0755
select-editor File 2.39 KB 0755
sensible-browser File 1.26 KB 0755
sensible-editor File 1.24 KB 0755
sensible-pager File 565 B 0755
seq File 46.51 KB 0755
session-migration File 22.15 KB 0755
setarch File 26.65 KB 0755
setfont File 50.32 KB 0755
setkeycodes File 14.23 KB 0755
setleds File 18.21 KB 0755
setlogcons File 14.23 KB 0755
setmetamode File 14.26 KB 0755
setpci File 30.38 KB 0755
setpriv File 38.38 KB 0755
setsid File 14.38 KB 0755
setterm File 34.38 KB 0755
setupcon File 38.31 KB 0755
sftp File 142.66 KB 0755
sg File 39.55 KB 4755
sg_bg_ctl File 14.51 KB 0755
sg_compare_and_write File 26.91 KB 0755
sg_copy_results File 23.3 KB 0755
sg_dd File 54.33 KB 0755
sg_decode_sense File 14.76 KB 0755
sg_emc_trespass File 14.3 KB 0755
sg_format File 39.35 KB 0755
sg_get_config File 35.39 KB 0755
sg_get_elem_status File 26.79 KB 0755
sg_get_lba_status File 22.95 KB 0755
sg_ident File 14.6 KB 0755
sg_inq File 119.61 KB 0755
sg_logs File 150.93 KB 0755
sg_luns File 22.79 KB 0755
sg_map File 18.3 KB 0755
sg_map26 File 26.7 KB 0755
sg_modes File 46.08 KB 0755
sg_opcodes File 35.01 KB 0755
sg_persist File 36.08 KB 0755
sg_prevent File 14.51 KB 0755
sg_raw File 26.91 KB 0755
sg_rbuf File 22.73 KB 0755
sg_rdac File 14.3 KB 0755
sg_read File 26.31 KB 0755
sg_read_attr File 36.65 KB 0755
sg_read_block_limits File 14.54 KB 0755
sg_read_buffer File 27.56 KB 0755
sg_read_long File 14.7 KB 0755
sg_readcap File 22.79 KB 0755
sg_reassign File 14.66 KB 0755
sg_referrals File 14.66 KB 0755
sg_rep_pip File 14.57 KB 0755
sg_rep_zones File 26.8 KB 0755
sg_requests File 22.76 KB 0755
sg_reset File 14.66 KB 0755
sg_reset_wp File 14.6 KB 0755
sg_rmsn File 14.51 KB 0755
sg_rtpg File 14.6 KB 0755
sg_safte File 22.7 KB 0755
sg_sanitize File 27.01 KB 0755
sg_sat_identify File 18.73 KB 0755
sg_sat_phy_event File 19.01 KB 0755
sg_sat_read_gplog File 18.73 KB 0755
sg_sat_set_features File 18.7 KB 0755
sg_scan File 18.3 KB 0755
sg_seek File 18.88 KB 0755
sg_senddiag File 27.2 KB 0755
sg_ses File 119.97 KB 0755
sg_ses_microcode File 27.36 KB 0755
sg_start File 18.85 KB 0755
sg_stpg File 22.73 KB 0755
sg_stream_ctl File 18.7 KB 0755
sg_sync File 14.66 KB 0755
sg_test_rwbuf File 18.6 KB 0755
sg_timestamp File 18.83 KB 0755
sg_turs File 26.7 KB 0755
sg_unmap File 22.76 KB 0755
sg_verify File 18.91 KB 0755
sg_vpd File 114.42 KB 0755
sg_wr_mode File 22.73 KB 0755
sg_write_buffer File 27.23 KB 0755
sg_write_long File 14.76 KB 0755
sg_write_same File 26.95 KB 0755
sg_write_verify File 26.79 KB 0755
sg_write_x File 55.6 KB 0755
sg_xcopy File 42.32 KB 0755
sg_zone File 14.86 KB 0755
sginfo File 72.01 KB 0755
sgm_dd File 38.31 KB 0755
sgp_dd File 46.31 KB 0755
sh File 122.74 KB 0755
sha1sum File 42.41 KB 0755
sha224sum File 50.41 KB 0755
sha256sum File 50.41 KB 0755
sha384sum File 58.41 KB 0755
sha512sum File 58.41 KB 0755
shasum File 9.75 KB 0755
showconsolefont File 18.23 KB 0755
showkey File 18.23 KB 0755
shred File 50.51 KB 0755
shuf File 46.51 KB 0755
size File 30.45 KB 0755
skill File 30.23 KB 0755
slabtop File 22.23 KB 0755
sleep File 34.51 KB 0755
slirp4netns File 50.77 KB 0755
slogin File 827.04 KB 0755
snap File 19.8 MB 0755
snapctl File 7.02 MB 0755
snapfuse File 38.23 KB 0755
snice File 30.23 KB 0755
socat File 383.62 KB 0755
soelim File 30.48 KB 0755
sort File 98.8 KB 0755
sos File 612 B 0755
sos-collector File 1.04 KB 0755
sosreport File 1.03 KB 0755
splain File 18.96 KB 0755
split File 50.97 KB 0755
splitfont File 14.15 KB 0755
sqfscat File 131.9 KB 0755
sqfstar File 254.68 KB 0755
ss File 125.07 KB 0755
ssh File 827.04 KB 0755
ssh-add File 166.42 KB 0755
ssh-agent File 286.43 KB 2755
ssh-argv0 File 1.42 KB 0755
ssh-copy-id File 12.38 KB 0755
ssh-import-id File 985 B 0755
ssh-import-id-gh File 785 B 0755
ssh-import-id-lp File 785 B 0755
ssh-keygen File 446.44 KB 0755
ssh-keyscan File 190.44 KB 0755
stat File 78.52 KB 0755
static-sh File 2.09 MB 0755
stdbuf File 42.51 KB 0755
strace File 1.88 MB 0755
strace-log-merge File 1.78 KB 0755
streamzip File 7.75 KB 0755
strings File 30.61 KB 0755
strip File 162.57 KB 0755
stty File 74.51 KB 0755
su File 54.38 KB 4755
sudo File 226.97 KB 4755
sudoedit File 226.97 KB 4755
sudoreplay File 87.64 KB 0755
sum File 34.41 KB 0755
sync File 34.41 KB 0755
systemctl File 1.06 MB 0755
systemd File 1.76 MB 0755
systemd-analyze File 1.73 MB 0755
systemd-ask-password File 18.48 KB 0755
systemd-cat File 18.38 KB 0755
systemd-cgls File 22.48 KB 0755
systemd-cgtop File 38.39 KB 0755
systemd-cryptenroll File 50.53 KB 0755
systemd-delta File 26.37 KB 0755
systemd-detect-virt File 18.37 KB 0755
systemd-escape File 22.37 KB 0755
systemd-hwdb File 118.66 KB 0755
systemd-id128 File 26.37 KB 0755
systemd-inhibit File 22.39 KB 0755
systemd-machine-id-setup File 18.48 KB 0755
systemd-mount File 50.59 KB 0755
systemd-notify File 22.38 KB 0755
systemd-path File 18.37 KB 0755
systemd-run File 62.57 KB 0755
systemd-socket-activate File 26.37 KB 0755
systemd-stdio-bridge File 22.38 KB 0755
systemd-sysext File 46.49 KB 0755
systemd-sysusers File 62.68 KB 0755
systemd-tmpfiles File 98.57 KB 0755
systemd-tty-ask-password-agent File 34.37 KB 0755
systemd-umount File 50.59 KB 0755
tabs File 18.3 KB 0755
tac File 98.41 KB 0755
tail File 66.52 KB 0755
tapestat File 26.44 KB 0755
tar File 505.81 KB 0755
taskset File 22.38 KB 0755
tbl File 126.48 KB 0755
tcpdump File 1.27 MB 0755
tee File 34.51 KB 0755
telnet File 107.56 KB 0755
telnet.netkit File 107.56 KB 0755
tempfile File 14.02 KB 0755
test File 42.44 KB 0755
tic File 86.41 KB 0755
time File 26.52 KB 0755
timedatectl File 46.37 KB 0755
timeout File 38.95 KB 0755
tkconch3 File 962 B 0755
tload File 18.24 KB 0755
tmux File 948.55 KB 0755
tnftp File 178.9 KB 0755
toe File 22.3 KB 0755
top File 130.06 KB 0755
touch File 90.51 KB 0755
tput File 26.34 KB 0755
tr File 46.51 KB 0755
tracepath File 18.15 KB 0755
trial3 File 958 B 0755
troff File 718.61 KB 0755
true File 26.3 KB 0755
truncate File 34.51 KB 0755
tset File 26.31 KB 0755
tsort File 46.51 KB 0755
tty File 30.51 KB 0755
twist3 File 958 B 0755
twistd3 File 960 B 0755
tzselect File 15.02 KB 0755
ua File 1003 B 0755
ubuntu-advantage File 1003 B 0755
ubuntu-bug File 2.51 KB 0755
ubuntu-distro-info File 22.89 KB 0755
ubuntu-drivers File 18.19 KB 0755
ubuntu-security-status File 22.25 KB 0755
ucf File 40.9 KB 0755
ucfq File 18.91 KB 0755
ucfr File 10.47 KB 0755
uclampset File 26.38 KB 0755
udevadm File 1.08 MB 0755
udisksctl File 58.38 KB 0755
ul File 22.38 KB 0755
umount File 34.38 KB 4755
uname File 34.51 KB 0755
unattended-upgrade File 97.21 KB 0755
unattended-upgrades File 97.21 KB 0755
uncompress File 2.29 KB 0755
unexpand File 34.53 KB 0755
unicode_start File 2.7 KB 0755
unicode_stop File 530 B 0755
uniq File 42.51 KB 0755
unlink File 30.51 KB 0755
unlzma File 82.52 KB 0755
unmkinitramfs File 3.69 KB 0755
unpigz File 134.36 KB 0755
unshare File 30.6 KB 0755
unsquashfs File 131.9 KB 0755
unxz File 82.52 KB 0755
unzip File 170.42 KB 0755
unzipsfx File 78.42 KB 0755
unzstd File 854.59 KB 0755
update-alternatives File 58.24 KB 0755
update-mime-database File 58.23 KB 0755
uptime File 14.23 KB 0755
usb-devices File 4.33 KB 0755
usbhid-dump File 30.38 KB 0755
usbreset File 14.3 KB 0755
users File 34.51 KB 0755
utmpdump File 22.38 KB 0755
uuidgen File 18.38 KB 0755
uuidparse File 22.38 KB 0755
vacuumdb File 9.21 KB 0755
vacuumlo File 9.21 KB 0755
validate-json File 6.66 KB 0755
vcs-run File 6.75 KB 0755
vdir File 134.98 KB 0755
vi File 3.61 MB 0755
view File 3.61 MB 0755
viewres File 31.23 KB 0755
vigpg File 2.58 KB 0755
vim File 3.61 MB 0755
vim.basic File 3.61 MB 0755
vim.tiny File 1.45 MB 0755
vimdiff File 3.61 MB 0755
vimtutor File 2.1 KB 0755
vm-support File 9.83 KB 0755
vmhgfs-fuse File 46.73 KB 0755
vmstat File 38.24 KB 0755
vmtoolsd File 74.56 KB 0755
vmware-alias-import File 42.52 KB 0755
vmware-checkvm File 14.38 KB 0755
vmware-hgfsclient File 14.38 KB 0755
vmware-namespace-cmd File 22.3 KB 0755
vmware-rpctool File 18.3 KB 0755
vmware-toolbox-cmd File 58.59 KB 0755
vmware-vgauth-cmd File 18.3 KB 0755
vmware-vmblock-fuse File 18.78 KB 0755
vmware-xferlogs File 32.33 KB 0755
w File 22.23 KB 0755
wall File 22.38 KB 0755
watch File 26.6 KB 0755
watchgnupg File 18.3 KB 0755
wc File 42.42 KB 0755
wdctl File 30.4 KB 0755
wget File 459.02 KB 0755
whatis File 47.28 KB 0755
whereis File 30.84 KB 0755
which File 946 B 0755
which.debianutils File 946 B 0755
whiptail File 30.16 KB 0755
who File 50.52 KB 0755
whoami File 30.51 KB 0755
wifi-status File 2.06 KB 0755
write File 22.38 KB 0755
write.ul File 22.38 KB 0755
wsrep_sst_backup File 2.39 KB 0755
wsrep_sst_common File 66.86 KB 0755
wsrep_sst_mariabackup File 49.47 KB 0755
wsrep_sst_mysqldump File 8.11 KB 0755
wsrep_sst_rsync File 29.72 KB 0755
wsrep_sst_rsync_wan File 29.72 KB 0755
x86_64 File 26.65 KB 0755
x86_64-linux-gnu-addr2line File 26.7 KB 0755
x86_64-linux-gnu-ar File 54.48 KB 0755
x86_64-linux-gnu-as File 456.4 KB 0755
x86_64-linux-gnu-c++filt File 22.27 KB 0755
x86_64-linux-gnu-dwp File 1.82 MB 0755
x86_64-linux-gnu-elfedit File 34.72 KB 0755
x86_64-linux-gnu-gold File 3.04 MB 0755
x86_64-linux-gnu-gprof File 111.79 KB 0755
x86_64-linux-gnu-ld File 1.66 MB 0755
x86_64-linux-gnu-ld.bfd File 1.66 MB 0755
x86_64-linux-gnu-ld.gold File 3.04 MB 0755
x86_64-linux-gnu-nm File 43.63 KB 0755
x86_64-linux-gnu-objcopy File 162.54 KB 0755
x86_64-linux-gnu-objdump File 365.13 KB 0755
x86_64-linux-gnu-ranlib File 54.48 KB 0755
x86_64-linux-gnu-readelf File 758.44 KB 0755
x86_64-linux-gnu-size File 30.45 KB 0755
x86_64-linux-gnu-strings File 30.61 KB 0755
x86_64-linux-gnu-strip File 162.57 KB 0755
xargs File 62.41 KB 0755
xauth File 54.96 KB 0755
xdg-user-dir File 234 B 0755
xdg-user-dirs-update File 26.23 KB 0755
xdpyinfo File 39.05 KB 0755
xdriinfo File 14.3 KB 0755
xev File 34.63 KB 0755
xfd File 40.01 KB 0755
xfontsel File 43.85 KB 0755
xkill File 14.3 KB 0755
xlsatoms File 14.3 KB 0755
xlsclients File 18.31 KB 0755
xlsfonts File 26.4 KB 0755
xmessage File 23.12 KB 0755
xprop File 48.61 KB 0755
xsubpp File 5.05 KB 0755
xvinfo File 18.3 KB 0755
xwininfo File 50.38 KB 0755
xxd File 18.28 KB 0755
xz File 82.52 KB 0755
xzcat File 82.52 KB 0755
xzcmp File 6.86 KB 0755
xzdiff File 6.86 KB 0755
xzegrep File 5.87 KB 0755
xzfgrep File 5.87 KB 0755
xzgrep File 5.87 KB 0755
xzless File 1.76 KB 0755
xzmore File 2.11 KB 0755
yarn File 1 KB 0755
yarnpkg File 1 KB 0755
yes File 30.38 KB 0755
ypdomainname File 22.23 KB 0755
zcat File 1.94 KB 0755
zcmp File 1.64 KB 0755
zdiff File 5.76 KB 0755
zdump File 26.21 KB 0755
zegrep File 29 B 0755
zfgrep File 29 B 0755
zforce File 2.03 KB 0755
zgrep File 7.91 KB 0755
zipdetails File 58.66 KB 0755
zipgrep File 2.89 KB 0755
zipinfo File 170.42 KB 0755
zless File 2.15 KB 0755
zmore File 1.8 KB 0755
znew File 4.47 KB 0755
zstd File 854.59 KB 0755
zstdcat File 854.59 KB 0755
zstdgrep File 3.78 KB 0755
zstdless File 30 B 0755
zstdmt File 854.59 KB 0755